KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_0589Help
Entry
BANAU_0589        CDS       T02050                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00440  Phosphonate and phosphinate metabolism
bya01100  Metabolic pathways
bya01120  Microbial metabolism in diverse environments
bya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BANAU_0589 (pepM)
Enzymes [BR:bya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BANAU_0589 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CCG48611
LinkDB All DBs
Position
633744..634634
Genome map
AA seq 296 aa AA seqDB search
MMVKNRKSSIFRDALNSKGLVKVAGAHDGLSAKLAEKNGFNAVWASGLGISAVQTVPDAS
ILTMTEFLEAAVIMNESCNLPVIADCDSGYGNIHNVTRMIKKYEAAGIAGVCIEDKVYPK
LNSFDDRQQILVSTEEFCAKIRAAKMAQQNDDFVLIARVEALIAKLGQEEAYTRAKAYVH
AGADAILIHSKEQSPDEIIEFVNNWDVDAPLVVVPTKYPTLSMEQLEKLGVKVSIYANQA
LRASVKAINDTFESIINNKSSLQIENDIVSVNEIFDIQDVPGMKQLERLIHRQPAN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgaaaaacagaaaatcatcaatttttagagatgctttaaacagtaaaggtttg
gtgaaagttgcgggagctcatgacggtttaagcgccaaattagcagagaaaaacggattt
aatgccgtatgggcaagcggtttgggaatctcggctgtgcaaactgtacctgatgccagt
atattaacgatgactgaatttcttgaagccgccgtcattatgaatgaatcatgcaatttg
ccggtcatcgctgactgtgattccggctacgggaacattcacaatgtcacccgcatgatc
aaaaaatacgaagctgctggtattgccggagtttgtattgaagataaagtatatccaaaa
ttaaactcatttgacgacagacaacagatccttgtcagtactgaagaattttgcgcaaaa
attagagccgcaaagatggctcagcaaaatgacgattttgtattgattgcccgtgtcgaa
gctttaattgctaaattgggtcaagaagaagcctatacaagagcaaaagcttatgttcat
gctggagcagatgcaattttaattcattcaaaagaacaatcgcctgatgaaattattgag
tttgttaacaattgggacgtggatgcgccgttggttgtggttccgactaaatatccgacg
ctctcaatggaacagcttgagaaattgggagtgaaggtttccatctatgcgaatcaggcg
ttgcgcgcttctgttaaggctataaatgatacattcgaaagcattataaataataaatcg
tctttgcagattgaaaatgacatcgtgagcgttaatgagatatttgacattcaagacgtt
ccggggatgaagcaactggagcgtttgatccatagacagccggctaactga

DBGET integrated database retrieval system