KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1526Help
Entry
BANAU_1526        CDS       T02050                                 

Gene name
sun
Definition
(GenBank) sun protein
  KO
K03500  16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Brite
KEGG Orthology (KO) [BR:bya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bya03009]
    BANAU_1526 (sun)
Enzymes [BR:bya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     BANAU_1526 (sun)
Ribosome biogenesis [BR:bya03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BANAU_1526 (sun)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltr_RsmB-F NusB Methyltransf_31 FtsJ Methyltransf_25 Methyltr_RsmF_N DUF2431 Ubie_methyltran MTS
Motif
Other DBs
NCBI-ProteinID: CCG49547
LinkDB All DBs
Position
1629949..1631292
Genome map
AA seq 447 aa AA seqDB search
MKKINVRELALEALEKLEQNQAYSNLLLTSVIKTNTLSDQDRGLLTELVYGTLQNKIALD
FMLKPFIRKPNKVKPWVIQLLRLSAYQMEYLEKIPDRAAIHEAVEIAKKRGHKGIASFVN
GILRSLQREGAPSFAEIEDPVLRLSTETSHPEWLVKEWVEAYGFEAAEKICRIHLIPPKQ
TLRVNHIKSDRETVLNEMENAGLEAEAGDLSPDAIKLLKGSIANTAFFQNGRVSIQDESS
MLVARALDPKPGETVLDACAAPGGKSAHIAELMENEGSLTSLDLHRHKVKLIKEGAERLG
LTIIDAQTMDARKAGEAFGAERFDRILVDAPCSGFGVIRRKPDMKYTKTPEDSRRLSEIQ
LGILREIAPLVKKGGTLVYSTCTMDRTENEEVMHAFIQEHPEFEPDLSLEKRLPEKARPF
VQDGSLQILPHYFGTDGFFISSMRKKG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattaatgtccgggagctcgccctcgaagcgcttgagaagcttgagcaaaat
caggcatacagcaacctgcttcttacatcggttatcaaaacgaacacgctcagcgatcag
gacagagggctgctgacagagcttgtctacggaacgctgcaaaataaaatcgccttagac
tttatgctgaagccttttatccgcaagccgaataaggtgaagccgtgggtgattcagctg
cttcgtctgtccgcgtatcaaatggagtatttagaaaaaattccggatcgcgccgccatc
catgaagcggttgaaatcgccaaaaaacgcgggcataagggcattgcgtcctttgtcaac
ggcatcctccgctccctgcagcgtgagggggcgccgtcattcgctgaaattgaagacccg
gttctccgtctttctacagagacaagccatcccgaatggctcgtaaaagagtgggtcgag
gcgtacggctttgaggcggctgaaaagatctgccggattcatctcattccgccgaagcag
acgctccgtgtcaatcacataaagagcgacagggaaacggtgctgaatgagatggagaat
gccggtctggaagcggaagccggagacctttctcctgatgcgattaagcttttaaaagga
agcatcgcgaacacggcatttttccaaaacggccgggtatccatacaggatgaaagctca
atgcttgtcgcgcgggcgctggacccgaagccgggcgaaaccgttttagacgcatgcgcc
gcaccgggcggaaagtcggctcacattgcggaactgatggagaacgaggggagcctcaca
tcgcttgatcttcaccgccataaagtgaagctgattaaagagggcgcagaacggctcgga
cttacgatcatcgacgcacaaacgatggatgcgcgaaaagcgggagaggcctttggcgca
gaacggtttgaccgtattctcgttgatgccccttgctcaggtttcggcgtcatcagaaga
aaacccgatatgaaatatacgaagacgccggaggacagcagacggctgtcagaaatccag
ctcggcattttaagggaaatcgccccattagtaaaaaaaggtggcacactcgtatacagt
acgtgtacaatggaccggacagaaaatgaagaagttatgcatgcgtttatacaagaacac
cctgagtttgaacccgatttgtctcttgaaaagcggctgcctgaaaaggcgagacccttt
gttcaggatggaagccttcaaattcttccgcattatttcggaacagacggtttctttatt
agcagcatgagaaagaagggataa

DBGET integrated database retrieval system