KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1529Help
Entry
BANAU_1529        CDS       T02050                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase, bacterial
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Brite
KEGG Orthology (KO) [BR:bya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bya01001]
    BANAU_1529 (prkC)
Enzymes [BR:bya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BANAU_1529 (prkC)
Protein kinases [BR:bya01001]
 Serine/threonine kinases: Other
  Bacterial family
   BANAU_1529 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like Kdo APH RIO1 Pkinase_fungal Seadorna_VP7 Haspin_kinase PBP_N
Motif
Other DBs
NCBI-ProteinID: CCG49550
LinkDB All DBs
Position
1633148..1635091
Genome map
AA seq 647 aa AA seqDB search
MLTGKRISGRYHILRPIGGGGMANVFLAEDIILEREVAIKILRFDFVNDNDFIRRFRREA
QSASSLDHPNIVSIYDIGEEGDIYYIVMEYVEGMTLKEYITAHGPLHPKEALSVMEQIVS
AIAHAHQNHIVHRDIKPHNILIDHLGHIKVTDFGIATALTSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGKIPFDGESAVSIALKHLQTETPSARKWNPSIPQS
VENIILKATAKDPFHRYESAEDMEADIRTAFDAGRLNEQKFSVQDDEEMTKAIPVITDGA
KAAPQAETPGETDDKEQQPAKKKKRKWPWVLLSVCFIFIMAAVLAVTVFPSLFMPKDVSV
PDVRGMKYEKAEALLEKNGLRADPDITDIEDEKIEEELMVKTDPKAGSTVKEGSSVKLYK
SIGKPKTQLIDVKGRQIGDAKKALKEKGFKHVNVKEENDDSEAGTVIDQDPSAGTDMVAS
DDEVNLTVSLGPADVTLRDLKTYSKEAASGYLEDNGLQLVEKQAHSDDVPKGQVMKQEPS
AGTAVKPGSNVEVTFSLGPEEKPAKTVKEKISIPYEPEHEGDELEVQIAIDDKDHSISDT
YDSFKIKEPTEKTIELKIDQGQKGYYQVMVDHKVVSYKTIEYPKDND
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccggcaagcggatcagcgggcgttatcatatcctccggcccattggcggcggc
ggaatggcaaacgtttttttagctgaggacatcattctcgaacgtgaagtcgcaattaaa
attctgcggtttgactttgtgaatgacaatgattttatcaggcgtttcagaagagaagca
cagtcggcatcaagcctcgatcatccgaatatcgtgagtatttacgatatcggggaggaa
ggcgatatttattacattgtcatggaatatgtggaaggcatgacattaaaggaatacata
accgcacacggaccgcttcatccgaaagaagcgctgtccgttatggagcagatcgtctcg
gccatcgcccatgcccatcaaaaccatatcgtgcatcgggatattaaaccgcacaatata
ttgatagaccatttagggcatatcaaggtgacggatttcggcatcgccacagcgcttacg
tctacgacaatcacacatacgaattctgtgctgggctcggttcattatttgtctccggag
caggcgagaggcggtcttgcaacgaaaaaatcagatatttacgcgctcggcatcgtgctg
tttgagcttttaacaggtaaaattccttttgacggagaatcagccgtcagcatagcgcta
aagcatctgcaaacagaaacgccttccgccagaaagtggaacccttccattccgcagagc
gtcgaaaacattattttaaaggcaaccgccaaagacccgtttcaccgctatgaaagcgcc
gaggacatggaagcggacatcagaacggcttttgacgccggcaggctgaatgaacaaaaa
ttttccgttcaggatgatgaggaaatgacaaaagccattcccgttattactgacggcgca
aaagccgcgcctcaggcggaaacgccgggggagacggacgataaggaacagcagcccgcc
aaaaagaaaaaacggaaatggccgtgggttttgctgtccgtttgtttcattttcattatg
gcggctgttcttgcggtcaccgtgttcccgtctttatttatgcctaaagatgtaagcgtc
cccgacgtacggggcatgaagtacgaaaaagcggaagccctgcttgaaaagaacgggctc
cgggcggatcctgatataacggacattgaagatgaaaaaatagaagaggaattaatggtc
aaaacggacccaaaagcggggtctaccgttaaagaaggctcttctgtaaaactgtacaaa
agcatcggaaaaccgaaaacccagctgatcgacgtgaaaggacggcagatcggcgacgca
aaaaaagcgctgaaggaaaaaggcttcaaacatgtcaatgtcaaagaagagaacgatgac
agcgaggccggcaccgtaattgatcaggacccgtcagccggcaccgacatggtcgcaagc
gacgatgaagtcaatctaacggtcagcctcggcccggcggacgttacgctgagggactta
aagacttacagcaaagaagcggcttcagggtatcttgaagataacggcctgcagcttgtt
gaaaaacaagcccattcagatgacgtaccaaaaggacaagtcatgaagcaagagccgtca
gccggcactgcggttaagccgggaagtaatgttgaagtgacgttctcgctcggacctgaa
gaaaaaccggcgaaaacggtaaaagaaaaaatcagcattccttacgaacccgaacatgaa
ggggacgagcttgaagtgcaaatcgccatcgatgataaggaccacagcatctctgatacg
tatgactcatttaaaataaaagagccgactgaaaaaacaattgaactgaagattgatcag
ggacagaaggggtattaccaagtgatggtcgatcataaagtcgtcagctacaaaacgatt
gaatacccgaaagataatgactga

DBGET integrated database retrieval system