KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1749Help
Entry
BANAU_1749        CDS       T02050                                 

Gene name
yonK
Definition
(GenBank) SPBc2 prophage-derived uncharacterized protein yonK
Organism
bya  Bacillus velezensis YAU B9601-Y2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YonK TM231
Motif
Other DBs
NCBI-ProteinID: CCG49770
LinkDB All DBs
Position
complement(1911774..1911974)
Genome map
AA seq 66 aa AA seqDB search
MEEFNLAKKVHTVNLKGNYTYIDGIIEEETKTDIERYDLNSILKSFDGRKVKISITEEDE
LPQINE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaatttaatttggctaagaaagttcatacagtaaatttaaaaggtaactatact
tacattgatgggattattgaagaagaaacaaaaacggacatcgagcgttatgatctgaat
tcaattttaaaatcatttgacggtcggaaagtgaagatttctattaccgaagaagacgaa
cttccacaaatcaatgagtag

DBGET integrated database retrieval system