KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1823
Entry
BANAU_1823        CDS       T02050                                 
Symbol
yosJ
Name
(GenBank) hypothetical protein
Organism
bya  Bacillus velezensis YAU B9601-Y2
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: CCG49844
LinkDB
Position
1979821..1980015
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcaccttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaataa

DBGET integrated database retrieval system