KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_2832Help
Entry
BANAU_2832        CDS       T02050                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00020  Citrate cycle (TCA cycle)
bya00480  Glutathione metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
bya01130  Biosynthesis of antibiotics
bya01200  Carbon metabolism
bya01210  2-Oxocarboxylic acid metabolism
bya01230  Biosynthesis of amino acids
Module
bya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bya_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BANAU_2832 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BANAU_2832 (citC)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BANAU_2832 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCG50853
LinkDB All DBs
Position
complement(3035785..3037056)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAKTLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSDAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaacgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccaaaacgctg
gaagacatcagagagtacttcatcgccatcaaaggtcctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcacgggagtgccttctccggtcaaacgtcctgaagatacggatatg
gtcattttccgcgagaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaggttgaaaagctgatcagcttcctgcaaaatgaaatgggtgttaacaaaatccgt
ttccctgaaacgtcaggaatcggcatcaaacctgtttctgaagaaggcacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgtaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgcc
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgacgcggaagcggcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttgacccgtccgagcgaattc
gacgtcgtggcgactatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacaggccatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaagtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaactgaagtgaaatgttcagagtttggtgaagagctaatcaaa
aacatggactga

DBGET integrated database retrieval system