KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_2867Help
Entry
BANAU_2867        CDS       T02050                                 

Gene name
acsA1
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00010  Glycolysis / Gluconeogenesis
bya00620  Pyruvate metabolism
bya00630  Glyoxylate and dicarboxylate metabolism
bya00640  Propanoate metabolism
bya00680  Methane metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
bya01130  Biosynthesis of antibiotics
bya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAU_2867 (acsA1)
   00620 Pyruvate metabolism
    BANAU_2867 (acsA1)
   00630 Glyoxylate and dicarboxylate metabolism
    BANAU_2867 (acsA1)
   00640 Propanoate metabolism
    BANAU_2867 (acsA1)
  09102 Energy metabolism
   00680 Methane metabolism
    BANAU_2867 (acsA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bya01004]
    BANAU_2867 (acsA1)
Enzymes [BR:bya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BANAU_2867 (acsA1)
Lipid biosynthesis proteins [BR:bya01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BANAU_2867 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Ribosomal_L6e_N
Motif
Other DBs
NCBI-ProteinID: CCG50888
LinkDB All DBs
Position
complement(3072219..3073805)
Genome map
AA seq 528 aa AA seqDB search
MLKREDLIAPKNYNLVNEIEKFSRSKEKNALIWEDQTGGKKVWTYEKLMEETNKIGARLK
GLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIKHAEVKGAIV
YPSFINAFDEVNTGQLVTLSIGENDAGWKNLLTIEADGDSFQTADTTREDMAFLSYTSGT
TGQPKGVVHTHGWAFAHLKTSAGAWLDISEDDTVWATAAPGWQKWVWSPLLAILGSGATG
VIYHGRFNAKTYLELLERHQVNVFCCTPTEYRLMAKVEELDKYDLSALHSAVSAGEPLNR
EVIDVFRKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINDKGEICE
TGETGDIAVHLSTPALFKEYYKDPERTKKQIRGDYFLTGDRAKKDEDGYFWFESRNDDII
VSSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQDDEKRSDELVKELQ
NHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRQREERLKADKKA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaatcgccccaaagaactataaccttgtaaatgaaatcgaa
aagttcagccgttccaaagagaagaacgcgcttatttgggaagatcaaacaggcggcaag
aaagtctggacgtatgaaaaattgatggaagaaacgaataaaatcggagcccgcctgaaa
ggtctcggatttgaaaaaggcgataagctgattgtcatggttccgagagtgcttgaagcg
tatgccgtttatttagcgatcttaaaagcggggatggtcgtcattccttgctcggaaatg
ctgcgcgccaaagaccttgaataccggatcaaacacgccgaagtgaaaggcgctatcgtt
tatccttcatttataaacgcgtttgacgaggtgaataccgggcagctggtgacattgtca
atcggtgaaaatgatgccggctggaaaaacctcctaacgattgaagcggacggagacagt
tttcaaacagctgatacaacaagagaagatatggcgtttttgtcctatacttcaggcacg
accggccagcctaaaggcgttgtacatacacacggctgggcctttgcccatttaaaaaca
tcagccggtgcatggctggatatttctgaagacgatacagtgtgggccaccgcggcgccc
ggctggcagaaatgggtgtggagcccgctgctcgcaattctgggaagcggcgcgacagga
gtcatttatcacggcagattcaacgccaagacgtatttagagctgctggagcgccatcaa
gtaaatgtcttctgctgtaccccgacggaataccgcctgatggcaaaagtggaggagttg
gacaaatatgatctttctgcccttcacagcgcagtttctgctggtgagccattaaaccgg
gaagtcattgacgtattccggaagcatttcggcattaaagtgagagacggatacggccaa
acggagagcaccctgttagtcggcgtcctgaaggatatggatattaagccgggaagcatg
ggcaaaccgacccctggaaatcaagtggagattataaacgataaaggcgaaatatgcgaa
acgggcgaaacgggcgatatcgccgtgcatttgagcacaccggccttattcaaggaatat
tataaagatcccgaaagaacgaaaaagcagattcgcggagattactttcttacaggagac
cgcgcgaaaaaagacgaggacggctacttttggtttgaaagccgcaatgatgacatcatc
gtcagctccggatatacaatcgggccttttgaagtagaggatgcgctcgtgaagcatccg
gaagtgaaagaatgtgccgtcgtggcgagcccggatgaaatcagaggttcaatcgtaaaa
gcttatgtcgttttacaagacgatgaaaagcgcagtgacgaacttgtcaaagaactgcaa
aaccacgtaaaaacgattacggcgccttacaaatatccgagagaaattgagtttgtcgaa
agcctgccgaaaacggcgtccgcaaaaatcagacgtgtggagctgagacagcgtgaagaa
cggctgaaggctgataaaaaagcataa

DBGET integrated database retrieval system