KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3183Help
Entry
BANAU_3183        CDS       T02050                                 

Gene name
fadN
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00071  Fatty acid degradation
bya00362  Benzoate degradation
bya00650  Butanoate metabolism
bya01100  Metabolic pathways
bya01120  Microbial metabolism in diverse environments
bya01200  Carbon metabolism
bya01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BANAU_3183 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BANAU_3183 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BANAU_3183 (fadN)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BANAU_3183 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CCG51204
LinkDB All DBs
Position
complement(3395026..3397395)
Genome map
AA seq 789 aa AA seqDB search
MHKFIKKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNELTKDEMKKGLTLESPEVRSR
LSRSAMQKLLKQKPAPLTSAANLDYITAGNLEDDAAQLKDADWIIEVVVENLDVKKQIFS
LVDEYRKPGSIVSSNTSGISVTKMAEGRSADFKAHFLGTHFFNPARYLKLLEIIPIQETD
PDVLEFMTSFAENTLGKGVVIAKDTPNFIANRIGTYGLLVTVREMLSSGCRIGEVDTVTG
PLIGRPKSATFRTLDVVGLDTFAHVAKNVYDKADGAEKDMFKLPEFMNDMLKNNWLGSKS
GQGFYKKEGKTIYELDPLTMTYGERSKMKTPALEAAKQAKGAKGKMKALIYSDDRAGRLL
WNITSQTLLYSARLLGEIADDIKAIDDAMKWGFGWELGPFEMWDAIGVRKSAERLEEEGA
EIPGWVKDMLDQGHETFYMKENGTPFYYSDGQYRAVKENPKRISLQTLKETKGVITKNSG
ASLIDLGDDVALLEFHTKSNAIGLDIIQMIDNALEETERNYKGLVIGNQGRHFCAGANLA
MILMEAQDDNFMEVDFVIRRFQQTMLNIKYSAKPVVAAPFGMTLGGGTEVCLPAARVQAA
SESYMGLVETGVGLIPGGGGNKELYMNYLNGGSELMDAAIKTFETIALAKVSGSAHEARD
MQILSAADRVSMNQDHLLHDAKQLAASLYDSGYRPPARKKVKVTGETGCAALLLGADQMR
RSGYLSDHDMKIAKKLAHVIAGGRVPFGTEVSEEYLLEIEREAFLSLAGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttataaagaaagcagccgttctcggatcaggcgtcatggggtccggaatt
gccgcgcacttggctaacatcggaattcccgtcctgctgcttgatattgtgccaaacgag
ctgacaaaggatgagatgaaaaaagggctgacattagaaagcccggaggtccgcagcagg
ctgagccgatcggccatgcaaaagctgctgaagcaaaaaccggcgccgctgacttcggct
gccaatctcgactatataactgcggggaatttggaagatgacgcagctcaattaaaggat
gctgattggattattgaagtcgtcgtcgaaaatcttgacgtaaaaaaacagattttctca
ctcgttgatgaataccggaaaccgggaagcatcgtgtcgagcaatacgtccggtatctcc
gtcacaaaaatggcggaaggccgatctgccgattttaaagcccatttcttaggaacccat
ttctttaatccggcccgctacttaaagcttctggaaatcattccgattcaggaaacagat
cctgacgtgctggagtttatgacttcatttgcagaaaacacgctcgggaaaggtgtcgtc
atcgcgaaagacacgcctaactttatcgccaaccgcatcggtacgtacggcctgctggtc
acggtaagagaaatgctttcttccggctgccgcatcggcgaggtggacacggtgaccggg
cctttgatcggcagaccgaaaagcgcgaccttcagaacccttgacgttgtggggcttgat
actttcgcccatgtggcaaaaaatgtgtatgataaagccgacggcgctgaaaaagacatg
tttaagctgcctgaatttatgaatgacatgctgaaaaacaattggctgggcagcaaatca
ggccaaggtttttacaaaaaagaaggtaaaacaatatatgaactcgatccgctgaccatg
acatacggtgagcgctcgaaaatgaagacgcccgctttagaagccgccaaacaggcaaag
ggtgccaaaggcaaaatgaaagcgcttatatactccgatgaccgcgccggacgcctgctt
tggaatattacatcgcaaacactcttatactcagcccggcttttaggtgagatcgctgat
gatatcaaagcgattgacgacgccatgaaatggggcttcggatgggagctcggcccgttt
gagatgtgggatgccatcggcgtcagaaaatcagcggagcggctcgaagaagaaggcgca
gaaatccccggctgggtgaaagatatgcttgatcagggccatgaaacattttatatgaag
gaaaacggaacaccattttactattcagacggccaatacagggctgtgaaagaaaatccg
aaacggatcagcctgcaaacgttaaaagaaacaaaaggcgttatcactaaaaacagcggc
gcaagtctgattgatctcggcgatgatgtcgcgctgctggaatttcatacgaaaagcaac
gcgatcggcttagacattattcagatgattgacaatgcgcttgaggaaaccgagcggaat
tataaaggacttgtcatcggaaaccaaggcagacatttctgcgcgggggcaaaccttgcg
atgattttgatggaagctcaggatgataacttcatggaagtcgattttgtcatccgccgt
tttcagcagacgatgctgaacatcaaatacagcgctaaacccgttgtcgcggcgccattc
gggatgacactcggcggcggcacggaagtctgtctcccggcggcacgcgttcaggcggcg
agcgaatcgtatatgggtcttgttgaaaccggcgtcggccttattccgggcggcggagga
aacaaagagctgtacatgaattatttgaacggcggaagtgaactgatggacgcggccatt
aaaaccttcgaaacaatcgcgcttgccaaagtgtccggttcggcacacgaagcccgtgat
atgcagattttgtccgcggcagaccgtgtcagcatgaatcaggatcacctgctgcacgat
gcgaaacagctggctgcttccttatatgacagcggataccgcccgcctgcccgcaaaaaa
gtgaaagtcaccggagaaaccggctgtgcggcattactgctcggagcagaccaaatgaga
cggtcgggttatttatccgatcacgatatgaagattgcgaagaagctggcccatgtcatt
gccggcggaagagtcccgttcggcacggaggtttcagaagaatatttactcgagattgaa
agagaagcctttttaagcctcgctggcgaggcgaaatctcaagcgagaatgcagcatatg
ctcgtcaaaggcaaacctttacggaactag

DBGET integrated database retrieval system