KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3188Help
Entry
BANAU_3188        CDS       T02050                                 

Gene name
yusO
Definition
(GenBank) HTH-type transcriptional regulator mhqR
Organism
bya  Bacillus velezensis YAU B9601-Y2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 Fe_dep_repress HTH_34 HTH_24 HTH_27 Penicillinase_R Rrf2 TrmB HTH_5 FeoC LexA_DNA_bind HxlR HTH_47 HTH_DeoR GntR B-block_TFIIIC HTH_Crp_2 HTH_IclR DUF2250 HTH_29
Motif
Other DBs
NCBI-ProteinID: CCG51209
LinkDB All DBs
Position
3399494..3399955
Genome map
AA seq 153 aa AA seqDB search
MKNADQYVSDIQKSLQTLLQNIQPEMVESMAKHEVTPAQLFVLASLKKHGSCKVSEIAER
MEVKPSAVTLMADRLEQKGLIVRKHNQQDRRVIDISLTKKGETKFEDVVEGRKAILARNL
SVLTDDELIQSVNIIRKVAEAAEKYAADQKENE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcggatcaatatgtgtctgacatccagaaatctcttcagacgctgctgcaa
aacatacagcctgaaatggtggaaagcatggcaaaacacgaggtgacgcctgcccaatta
tttgttttagccagcctgaaaaaacacgggagctgcaaagtttccgaaattgcggaacgc
atggaggtaaaaccgagcgcagtgacgctgatggccgaccgcctcgagcaaaaaggactt
atcgtccgcaaacataaccagcaggacagacgcgtcatcgacatcagcctcaccaaaaaa
ggcgaaacaaaattcgaagatgttgtggaaggacggaaagcgatactggcgcgaaacctg
tccgttctgactgacgatgaactgattcagtccgtgaacatcatccgcaaagtagcggaa
gccgccgagaaatacgcggctgatcaaaaagaaaacgaatag

DBGET integrated database retrieval system