KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3193Help
Entry
BANAU_3193        CDS       T02050                                 

Gene name
yusU
Definition
(GenBank) putative protein yusU
Organism
bya  Bacillus velezensis YAU B9601-Y2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF5444 GEN1_C
Motif
Other DBs
NCBI-ProteinID: CCG51214
LinkDB All DBs
Position
complement(3404687..3404932)
Genome map
AA seq 81 aa AA seqDB search
MEEKLQQQLDGLLEKYTELLLGETNPDVKEEVRQWILYTHIAKSMPPLVKHWNQSYPDAK
EGIKAAIQHIKQLNEAHRKKQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaactgcagcagcagctggacggcctgcttgaaaaatacacggaactattg
cttggcgaaacaaacccggatgtaaaggaagaagtcaggcagtggattttgtatacacat
atcgcaaaaagcatgcctccgctcgtcaaacattggaatcaatcctacccggacgccaaa
gagggcatcaaagctgcgatacagcacattaaacagctcaatgaagcacacagaaaaaaa
caataa

DBGET integrated database retrieval system