KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3389Help
Entry
BANAU_3389        CDS       T02050                                 

Gene name
hisI
Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00340  Histidine metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01230  Biosynthesis of amino acids
Module
bya_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BANAU_3389 (hisI)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BANAU_3389 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BANAU_3389 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: CCG51410
LinkDB All DBs
Position
complement(3599565..3600185)
Genome map
AA seq 206 aa AA seqDB search
MKRADELRFDEAGLIPAIVQDAASKEVLTLAYMNRESYEKTIETKETWFYSRSRQELWHK
GATSGNTQKVKAIRYDCDQDALVVLAEPSGPACHKGSYSCFSSEKADAQDRFGILNELES
VIAKRQAEMPDGAYTTYLFREGVDKILKKVGEEAAEVIIAAKNRDHEELKWEAADLLYHL
LVLLREQSLPLDDVLDVLAKRHSASE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcagatgaactgcggtttgacgaggccggactgattcccgccatcgtacag
gatgcggcaagcaaagaagtgctgacactggcttatatgaatcgtgaatcctacgaaaaa
acgatagaaacgaaagaaacctggttttacagccgttcacggcaggagctgtggcataaa
ggagcgacatcagggaatacccaaaaggtgaaagccatccgttatgactgcgatcaagat
gccctcgtcgtgcttgcggagccctcaggacccgcctgccataaaggaagttacagctgc
ttttcctcggaaaaagcggacgcgcaggatcgtttcggcatcttaaacgaactggaaagc
gtaatcgccaaacggcaggcggagatgcctgacggagcctacacaacgtatctgtttcgg
gaaggcgtcgataaaatcctcaaaaaagtcggcgaagaagccgcagaggttattatcgcc
gccaaaaatcgcgaccatgaagaattaaaatgggaagcggcggatttgctgtatcatttg
ctcgttcttctgcgtgagcagtcgcttcctttggacgacgtgcttgacgtccttgcaaaa
cgccattcagcatctgagtaa

DBGET integrated database retrieval system