KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3440Help
Entry
BANAU_3440        CDS       T02050                                 

Gene name
hag
Definition
(GenBank) Flagellin A Flagellin core protein
  KO
K02406  flagellin
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya02020  Two-component system
bya02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BANAU_3440 (hag)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BANAU_3440 (hag)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bya02035]
    BANAU_3440 (hag)
Bacterial motility proteins [BR:bya02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    BANAU_3440 (hag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C HlyD_2 MRP-S27 YjeJ Rh5 Tropomyosin_1
Motif
Other DBs
NCBI-ProteinID: CCG51461
LinkDB All DBs
Position
complement(3682549..3683550)
Genome map
AA seq 333 aa AA seqDB search
MRINHNIAALNTSRQLNAGSNSAAKNMEKLSSGLRINRAGDDAAGLAISEKMRSQIRGLD
MASKNAQDGISLIQTSEGALNETHSILQRMSELATQAANDTNTDSDRSELQKEMDQLASE
VTRISTDTEFNTKKLLDGTAQNLTFQIGANEGQTMSLSINKMDSESLKVGTTYTVSDDQN
TLTAADGSTATWADEEKDGTTGEVTKAAGYYDAGGKVIASEKLAADSKVTKGIDISSSAK
AASSALTTIKTAIDTVSSERAKLGAVQNRLEHTINNLGTSSENLTSAESRIRDVDMASEM
MEYTKNNILTQASQAMLAQANQQPQQVLQLLKG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaaccacaatatcgcggctcttaacactagccgtcagctgaatgcaggttca
aactctgctgcaaaaaacatggaaaaattatcttcaggtcttcgcatcaaccgcgctggt
gatgacgctgcgggtcttgcgatctctgaaaaaatgcgttctcaaatccgcggtttagac
atggcgtctaaaaacgctcaagacggaatctctcttatccaaacatctgagggtgcattg
aacgaaactcacagcattcttcagcgtatgagcgagcttgctacacaggcggcaaacgat
acaaacacagattctgaccgttctgagcttcaaaaagagatggaccaattagcgtctgaa
gtaacaagaatctctactgacactgagttcaatacgaaaaaacttcttgacggaactgcg
caaaaccttacgttccaaatcggagctaacgaagggcaaacaatgagcctgtctatcaat
aaaatggactctgaaagcctgaaagttggtacgacttatacagtatccgatgatcaaaat
acacttacagcagctgacggaagcactgctacttgggcggatgaagaaaaagacggcact
actggtgaagtaacaaaagctgctggatattacgatgcgggcggtaaagttattgcatct
gaaaaattagctgcagattctaaagtaacaaaaggtatcgacatctcttcttcagctaaa
gctgcgtcttcagctcttacaacaatcaaaacagctatcgacacagtatctagcgagcgc
gctaaacttggtgcggttcaaaaccgtttagagcacacaatcaacaaccttggtacttct
tctgagaacctgacttctgctgaatcacgtatccgtgacgtagacatggcttctgagatg
atggagtacacgaaaaacaacatccttactcaggcttctcaagctatgcttgcgcaagct
aaccaacagcctcagcaagttcttcaattgctgaaaggttaa

DBGET integrated database retrieval system