KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3586Help
Entry
BANAU_3586        CDS       T02050                                 

Gene name
atpD
Definition
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00190  Oxidative phosphorylation
bya01100  Metabolic pathways
Module
bya_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BANAU_3586 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bya00194]
    BANAU_3586 (atpD)
Enzymes [BR:bya01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BANAU_3586 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BANAU_3586 (atpD)
Photosynthesis proteins [BR:bya00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BANAU_3586 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase AAA NB-ARC NACHT T3SS_ATPase_C LPD3 ATPase_2 ABC_tran AAA_7 AAA_16 AAA_19 AAA_22 RNA_helicase AAA_30 TrwB_AAD_bind ATPase
Motif
Other DBs
NCBI-ProteinID: CCG51607
LinkDB All DBs
Position
complement(3823406..3824827)
Genome map
AA seq 473 aa AA seqDB search
MKKGRVSQVLGPVVDVRFEDGHLPAIYNAIKVSQPATGENEVGIDLTLEVALHLGDDTVR
TIAMASTDGIQRGMEAVDTGAPISVPVGDVTLGRVFNVLGDKIDLNEPLPADAQKDPIHR
SAPSFDELSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHG
GISVFAGVGERTREGNDLFYEMSDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEHFR
DKQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSV
TSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVG
EEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQF
TGQKGSYVPVKETVRGFKEILSGKYDHLPEDAFRLVGRIEEVIENAKEMGVEV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggacgcgtaagtcaggtgcttggaccggttgtcgacgtacgtttcgaggac
ggccacttgcctgcgatttataatgcgattaaagtttcacagccagctacaggcgaaaat
gaagtaggcatcgacctaacgctagaggttgctcttcatttaggtgacgatacagtccgt
acaattgccatggcatctacggacggaattcagcgcggaatggaagctgttgatacaggt
gcgccgatttctgttcctgtcggtgatgtgactctcggacgcgtatttaacgtactggga
gataaaattgatttaaatgaaccgctgcctgcggatgctcaaaaggacccgatccacaga
tcagctccttcattcgatgagctttcaactgaggttgaaattcttgaaacgggaattaag
gttgttgacctgctcgctccttacatcaagggcggtaaaatcggattgttcggcggcgcc
ggcgtaggtaaaaccgtattaatccaggaattaatcaacaacatcgcgcaagagcacggc
ggtatttccgtattcgccggtgtaggagagcgtactcgtgaagggaacgaccttttctac
gaaatgagcgattcaggcgttatcaagaaaacagccatggtcttcggacaaatgaacgag
ccgccgggcgcacgtatgcgtgtagcactgacgggtcttacaatggctgagcatttccgt
gataaacaaggacaggacgtactgttctttatcgataacattttccgtttcacacaagcg
ggttcagaggtttccgcgcttctcggccgtatgccttctgcggttggttatcagccgacg
cttgcgacagaaatgggtcagcttcaagagcgtattacgtctacaaacgttggttcagtt
acatctatccaggcgatctacgtgcctgccgatgactacactgacccggctccggcgaca
acgttcgctcacttggatgcaacgactaaccttgagcgtaaattaactgaaatgggtatc
taccctgcggttgatccgctggcttccacttcccgcgcgcttgctccggaaattgtcgga
gaagagcattatgcggtggcgcgtgaagtccagtcaacgcttcagcgttacaaagaactt
caggatattatcgcgattctcggtatggacgaattaggtgaagaagacaagcttgtcgtt
caccgcgcccgccgtatccagttcttcctttctcaaaacttccacgtagctgagcagttt
acgggacaaaagggttcttacgtgcctgttaaagaaacggtacgaggctttaaagaaatc
ctttccggtaaatatgaccatcttccggaagatgcattccgtcttgtgggacgcattgaa
gaagtcattgagaatgcgaaagagatgggtgtagaagtttaa

DBGET integrated database retrieval system