KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3880Help
Entry
BANAU_3880        CDS       T02050                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Brite
KEGG Orthology (KO) [BR:bya00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BANAU_3880 (ahpF)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BANAU_3880 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CCG51900
LinkDB All DBs
Position
4128313..4129842
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRTGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITF
VDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSVPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgacgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaac
gacattgttctcaaagtaagcgccggtgacgatgacacttctaaggacatgctggctctc
gttgacgagctggcttccatgtcatctaaaatttcagttgaaaaaactgaattaaacaga
acaccgagtttcagcgttaatcgtaccggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacatcattagtgctggcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgcttt
gagtcttatatcagcctgacgtgccacaactgccctgatgtcgtccaagcattaaacatg
atgagcgtgctcaacccgaatatcacacatacaatgattgacggcgcggcattcaaagaa
gaagtagaaagcaaaaacattatggctgttccgactgttttcttaaacggtgaatctttc
ggaagcggccgtatgaccatcgaagagattctcgcgaaaatgggcagcggcgcagatgcg
tctgagtttgccgacaaagagccatttgacgttcttgttgtcggcggcggacctgccggc
gcaagcgcggcgatctacacggcgcgtaaaggcatccgcaccggtgtcgtcgctgaacgc
ttcggcggccaggtactcgacaccatgagcatcgagaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgccgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaaccttcagcgtgcgaaacgccttgagaaaaaagacctcttcgaacttgaacttgaa
aacggcgctgtactgaaaagtaaaacagtgatcctttcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgttgcatactgcccgcactgt
gacggaccattgtttgaaggcaaagacgtagcggttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgtcaatcacgtgactgtgctggaattcgcgcct
gaactgaaagcagacgaagtcctgcaaaaacgtctttacagcctgccaaacgtcactgtg
cacaaaaatgcacaaacgaaagaaatcactggcgatcaaaacgtaaacggcattacgttc
gttgaccgtgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgcctaatacagaatggttagacgaaactgtcgaacgcaaccgcatcggcgaa
atcatcgtcgataagagcggcgcgacaagcgttcccggcctatttgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctccatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaattaa

DBGET integrated database retrieval system