KEGG   Burkholderia sp. YI23: BYI23_A000410Help
Entry
BYI23_A000410     CDS       T01711                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00970  Aminoacyl-tRNA biosynthesis
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BYI23_A000410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A000410
Enzymes [BR:byi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BYI23_A000410
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BYI23_A000410
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A000410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3941
Motif
Other DBs
NCBI-ProteinID: AET87879
UniProt: G8M9D7
LinkDB All DBs
Position
1:49394..50869
Genome map
AA seq 491 aa AA seqDB search
MNMQWEVVIGLETHAQLSTVSKIFSGAPTQFGASPNSQASPVDLALPGVLPVMNRGAVER
AIRFGLAIGSHIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGTITIQVPANEKAGKE
AYSKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAK
ALHGLVVWLGICDGNMQEGSFRCDANVSVRPVGQQEFGTRAEIKNLNSFRFLEEAIQYEV
RRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDASWIERV
KGEMPELPADMQKRFVDTYGLTPYDAGVLTSSKAMASYFEALVQKAGESQAKIAANWMMG
DVSAQLNRESLDIGESPVSAAQLALILQRIADGTISNKIAKDIFQTIWEEKATDDAAADR
IIEAKGLKQISDTGALEAIIDEVLAANQKSVDEFRAGKEKAFNALIGQAMKATKGKANPQ
QVNELLKKKLS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcagtgggaagtcgtcatcggtctggaaacgcacgcgcagctttcgaccgtc
tccaagattttttcgggcgcgcccacgcagttcggcgcgagcccgaactcgcaggcgagc
cccgtcgatctggcgctgcccggcgtgctgcccgtgatgaaccgcggcgccgtcgagcgc
gcgattcgcttcggtctcgcgatcggctcgcacatcgcgccgcgcagcatcttcgcgcgc
aagaactacttctatccggatctgccgaagggctatcagatcagccagtacgagattccg
gtcgtgcagggcggcacgatcacgatccaggttccggccaacgagaaggccggcaaggaa
gcgtattcgaagaccatcaacctgacgcgcgcgcatctggaagaagacgccggcaagtcg
ctgcacgaagacttcgcgggcatgacgggcatcgacctgaaccgcgcgggcacgccgctg
ctcgagatcgtcaccgagccggaaatgcgcagcgccgcggaagcggtcgcgtatgcgaag
gcgctgcacggtctcgtcgtgtggctcggcatctgcgacggcaacatgcaggaaggctcg
ttccgctgcgatgcgaacgtgtcggtgcgtccggtgggccagcaggaattcggcacgcgc
gccgaaatcaagaacctcaactcgttccgcttcctcgaagaggcgatccagtacgaagtg
cgccgtcagatcgagctgatcgaagatggcggcacggtggttcaggaaacgcgtctttac
gatccggacaagcgcgaaacgcgctcgatgcgcagcaaggaagacgcgcacgattaccgc
tatttcccggacccggacctgatgccgctcgtgatcgatgcatcgtggatcgagcgcgtg
aagggcgagatgcccgaactgccggcggacatgcagaagcgtttcgtcgatacctacggc
ctgacgccgtacgacgcgggcgtgctgacttcgtcgaaggcgatggcgtcgtacttcgag
gcgctcgtgcagaaagcaggcgaaagccaggccaagatcgccgcgaactggatgatgggc
gacgtctccgcgcaactgaaccgcgaatcgctcgatatcggcgaatcgccggtgtcggct
gcgcaactcgcgctgattctgcagcgcatcgccgacggcaccatctcgaacaagatcgcg
aaggacatctttcagacgatctgggaagagaaggcgaccgacgacgcggccgcggatcgc
atcatcgaggcgaagggcctgaagcagatttcggacaccggcgcgctcgaagcgatcatc
gacgaggtgctcgcggccaatcagaaatcggtcgatgaattccgcgcgggcaaggagaag
gcgttcaacgcgctgatcggccaggcgatgaaggcgaccaaaggcaaggcgaatccgcag
caggtcaacgagctgctgaagaaaaagctatcctga

DBGET integrated database retrieval system