KEGG   Burkholderia sp. YI23: BYI23_A004760Help
Entry
BYI23_A004760     CDS       T01711                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BYI23_A004760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:byi01002]
    BYI23_A004760
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:byi01011]
    BYI23_A004760
Enzymes [BR:byi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BYI23_A004760
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BYI23_A004760
Peptidases [BR:byi01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BYI23_A004760
Peptidoglycan biosynthesis and degradation proteins [BR:byi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BYI23_A004760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AET88314
UniProt: G8M4U9
LinkDB All DBs
Position
1:complement(535084..536796)
Genome map
AA seq 570 aa AA seqDB search
MSALSISASQLVYNSRFPRRDARPCTRRSPLSAQEQRSSMPLASRFASRRLSSFALAAVL
ACAALGPAPAAFARGGTKAESQAQSPERAAKGKRAAKNGKAARVAKASVPAGPLPASVMT
ALARAHVPLSSMSVVVQRIGAPTPLVSINANEPMLPASTMKLVTTYAGLSILGPDYRWKT
TAYADGQIDTQGVLRGNLYIQGTGDPKLVPEELIDLVDQIRKNGITGIDGALVLDKRYFD
ASTRDLPAFDNDDSAPYNVGPDPLLYAFKSLSFTLTPNADGQVAIDVLPQLAQLQIDNEL
RVTRGACVGSLSAASPSVAQTQGGFVQASFIGDYPLRCGSRTVNVAALDHSTFFAGGFLA
LWKQAGGTFQGATREGPTPSGARLVGTHRSPVLSDVVRDINKFSNNVMARNLFLTIGAAQ
LKPPATTAKSAAAIQSFLKRSALPMNGLALDNGSGLSRDEHISAASLADLLQAANASPVA
QVFVESLPIAGVDGTMRNRLTNAGAFGNAHIKTGTLRDVRAIAGYVGAANGESYVIVSFI
NDPRAEAARAAHDALLEWVYEGARKADLAE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atttccgccctttcgatttccgcaagccagcttgtctacaatagccgcttcccgcgccgc
gacgcccgcccgtgcacgcgccgcagcccgttatcagcccaagaacaacgctcgtccatg
ccgctcgcttcccgtttcgcgtcccgccgtctttcctcgttcgcgctcgccgccgttctc
gcctgcgcggcgctcggccctgcgcccgctgccttcgcacgcggcggcacgaaagccgaa
tcgcaggcgcagtcgccggagcgcgcggcgaaaggcaagcgcgccgcgaagaacgggaaa
gccgcgcgcgtcgcgaaggcgagcgtgccggccggaccgctgcccgcatcggtcatgacg
gcgctcgcgcgcgcgcacgtgccgctttcgtcgatgagcgtcgtcgtccaacgcatcggc
gcgcccacgccgctcgtctcgatcaacgcgaacgagccgatgctgcccgcttccacgatg
aagctcgtcaccacgtacgcgggcctctcgatactcgggcccgactatcgctggaagacg
accgcctacgccgacggccagatcgacacgcaaggcgtgctgcgcggcaatctctacatt
cagggcacgggcgaccccaagctcgtgccggaagaattgatcgatctcgtcgaccagatc
cgcaagaacggcatcaccggcatcgacggcgcgctggtgctcgacaagcgctatttcgac
gcctccacgcgcgatctgcccgccttcgacaacgacgacagcgcgccgtacaacgtcggt
cccgatccgttgctctatgcgttcaagtcgctgtccttcaccctgacgccgaacgcggac
gggcaagtggccatcgacgtcttgccgcagctcgcgcaactgcagatcgataacgaactg
cgcgtcacgcgcggcgcgtgcgtcggctcgctttcggcggcgtcgccgagcgtcgcgcag
acgcagggcggcttcgtgcaggcgtcgttcatcggcgactatccgctgcgctgcggctcg
cgcaccgtcaacgtcgccgcgctcgatcattcgacgttcttcgcgggcggctttctcgcg
ctgtggaagcaggccggcggcacgttccagggcgcgacgcgcgaaggcccgacgccgtcg
ggcgcgcggctcgtcggcacgcatcgcagcccggtgctgtcggatgtcgtgcgcgatatc
aacaagttcagcaacaacgtgatggcgcgcaacctgttcctcacgatcggcgcggcgcag
ttgaagccgcccgcgacgacggcgaagtccgccgcggcgatccagtcgttcctgaagcgc
agcgccttgccgatgaacggcctcgcgctcgacaacggttcgggcctttcgcgcgacgag
cacatcagcgcggcttcgctcgccgatctgctgcaggcggcgaacgcgagtccggtcgcg
caggtgttcgtcgaatcgctgccgatcgcgggcgtcgacggcacgatgcgcaaccgtctc
accaacgcgggcgcgttcggcaatgcgcacatcaagaccggcacgctgcgcgacgtgcgc
gcgatcgcgggctatgtcggcgcggcgaacggcgagagctacgtgatcgtgagcttcatc
aacgatccgcgcgccgaggctgcgcgcgccgcccacgacgcgctgctcgaatgggtctac
gagggcgcgcgcaaggcggatctggcggagtga

DBGET integrated database retrieval system