KEGG   Burkholderia sp. YI23: BYI23_A005210Help
Entry
BYI23_A005210     CDS       T01711                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
byi  Burkholderia sp. YI23
Pathway
byi03030  DNA replication
byi03410  Base excision repair
byi03420  Nucleotide excision repair
byi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BYI23_A005210
   03410 Base excision repair
    BYI23_A005210
   03420 Nucleotide excision repair
    BYI23_A005210
   03430 Mismatch repair
    BYI23_A005210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:byi03032]
    BYI23_A005210
   03400 DNA repair and recombination proteins [BR:byi03400]
    BYI23_A005210
Enzymes [BR:byi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BYI23_A005210
    6.5.1.6  DNA ligase (ATP or NAD+)
     BYI23_A005210
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BYI23_A005210
DNA replication proteins [BR:byi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BYI23_A005210
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BYI23_A005210
DNA repair and recombination proteins [BR:byi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BYI23_A005210
   NER (nucleotide excision repair)
    Other NER factors
     BYI23_A005210
   MMR (mismatch exicision repair)
    Other MMR factors
     BYI23_A005210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AET88359
UniProt: G8M4Z4
LinkDB All DBs
Position
1:complement(593736..595391)
Genome map
AA seq 551 aa AA seqDB search
MKRFATLYTALDATTSTNEKLEALIAYFAGAAPEDAAWASYFLAGGKPRQSVPTRLLAEF
ARERAGLPEWLFEESYQAVGDLAETIAHVLPAASGESSLGLAQWIEERVLTLRGASPVEL
RERLLSYWDELDWSERFLLTKLIGGGFRVGVARQLVVRALAEIAGVDHKRIAQRMVGWTD
SRQTPSAARYLRLIAPAADGDDVDTPHESDIGLPYPFFLAHPLQTDPATLGATSEWIAEW
KWDGIRAQLVKRAGRVWIWSRGEDLVTERFPELANLGAALPDGTVIDGEILAWEPGADAP
LPFARLQPRITRKSLTKKVLADSPAALLAYDLLEADGRDLRTEPLHARRARLDTLAASLA
VDVLRVSPMVAASGWEALAALREESRARGVEGLMLKERASMYGVGRTKASGTWWKWKIDP
YAIDAVLLYAQRGHGRRASLYTDFTFAVWDEADGMRTLVPFAKAYSGLTDEEMRQVDAIV
RKTTIEKFGPVRSVTPTLVFEIGFEGIQASPRHKSGIAVRFPRMLRWRTDKQIEDADTLD
MLKGFLNEATA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttcgcgacgctctacaccgcgctcgacgcgacgacatcgaccaacgaaaag
ctcgaagcgctgatcgcgtatttcgcgggcgcggcaccggaagacgccgcgtgggcgtcg
tactttctcgcgggcggcaagccgcgccagtcggtgccgacgcgcctgctcgccgagttc
gcgcgcgagcgcgcgggcttgcctgaatggctcttcgaagagtcgtatcaggcggtcggc
gatcttgcggaaaccatcgcgcatgtgttgccggcggcgtcgggcgaatcgtcgctcgga
cttgcgcaatggatcgaggaacgcgtgctcacgctgcgcggcgcgtcgcccgtcgaactg
cgcgagcggctcctgtcgtactgggacgaactcgactggagcgagcgcttccttttgacc
aagctgatcggcggcggctttcgcgtgggcgtcgcgcggcagctcgtcgtgcgcgcgctg
gccgagatcgcgggcgtcgatcacaaacgcattgcccagcgcatggtcggctggaccgat
tcgcggcagacgccgagcgccgcgcgctatttacggctcatcgcgcccgcggccgatggc
gacgatgtcgatacgcctcacgaaagcgatatcggtctgccctatccgttcttcctcgcg
catccgttgcagaccgatccggcgacgctcggcgcgacatccgagtggatcgccgaatgg
aagtgggacggcatacgcgcgcagctcgtgaagcgcgcgggccgcgtgtggatctggtcg
cgcggcgaagatctcgtcacggaacgctttccggaactcgccaacctgggcgcagcgttg
cccgacggcaccgtgatcgatggcgagattctcgcgtgggagccgggcgccgacgcgccc
ttgccgttcgcgcgcctgcagccgcgcatcacgcgcaagtcgctgacgaagaaagtgctc
gccgattcgcccgccgcgctgctcgcctacgatctgctcgaagccgatgggcgcgatctg
cgcaccgagccgctgcatgcgcggcgcgcccggctggatacgctcgcggcatcgctcgcc
gtggacgtgctgcgcgtatcgccgatggtcgctgcatccggctgggaagcgctcgccgcg
ttgcgcgaggaaagccgcgcgcgcggcgtcgaaggactcatgctcaaggaacgcgcgtcg
atgtacggcgtcgggcgcacgaaggcatcgggtacgtggtggaagtggaagatcgatcct
tatgcgatcgacgccgttttgctctacgcgcagcgcggccacggacggcgcgcgagcctc
tacaccgatttcaccttcgccgtctgggacgaagccgatggcatgcgcaccctcgtgccc
ttcgcgaaggcgtactccggtctgaccgacgaggaaatgcgccaggtcgatgccatcgtg
cgcaagacgacgatcgagaagttcgggccggtaaggagcgtcacgcccacgctcgtcttc
gagatcggcttcgaaggcatacaggcgagcccgcggcacaaatcgggcatcgcggtgcgc
tttccgcgcatgctgcgctggcgcaccgacaagcagatcgaagacgccgatacgctcgac
atgctcaagggctttctcaacgaggccacggcatga

DBGET integrated database retrieval system