KEGG   Burkholderia sp. YI23: BYI23_A005350Help
Entry
BYI23_A005350     CDS       T01711                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00020  Citrate cycle (TCA cycle)
byi00480  Glutathione metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
byi01210  2-Oxocarboxylic acid metabolism
byi01230  Biosynthesis of amino acids
Module
byi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
byi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BYI23_A005350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BYI23_A005350
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BYI23_A005350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AET88373
UniProt: G8M588
LinkDB All DBs
Position
1:610975..612231
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKIPADGDKITVNADFSLNVSDQPIIPYIEGDGTGVDITPVMIKVVDAAVEKAYG
GKRKIQWMEIFAGEKATRVYGPDVWLPDETLDAVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVRYFKGVPSPVREPEKIDMVIFRENSEDIYAGVEWPAESPEAKKVIKF
LREEMGVKKIRFPDSSGLGIKPVSREGTERLVRKAIQYAIDNDRRSVTLVHKGNIMKFTE
GAFRDYGYALAQKEFNAELIDGGPWMKVKNPKSGNDIVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWFEAADRIIASMEQSILSKRVTYDFARLMEGATQVSCSGFGAVMIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaagattccggcggacggtgacaagatcaccgtcaacgcggat
ttctcgctcaatgtctcggatcagccgatcatcccgtacatcgagggcgacggcacgggc
gtcgacatcacgccggtgatgatcaaggtcgtcgatgcggcggtggaaaaggcctacggc
ggcaagcgcaagatccagtggatggaaatcttcgccggcgaaaaggcgacgcgcgtctac
ggcccggacgtctggctgccggacgaaaccctcgacgcggtgaaggattacgtcgtgtcg
atcaaagggccgctcacgacgccagtcggcggcggcatccgttcgctcaatgttgcgctt
cgtcagcaactcgatctgtacgtgtgcctgcgcccggtgcgttacttcaagggcgtgccc
tcgccggtgcgcgagcccgagaagatcgacatggtgatcttccgcgagaactcggaagac
atctatgcgggtgtcgaatggccggcggagtcgcccgaagcgaagaaagtcatcaagttc
ctgcgcgaggaaatgggcgtgaagaagatccgctttccggattcgtcggggctcggcatc
aagccggtgtcgcgcgaaggcacggagcggctcgtgcgcaaggcgatccagtacgccatc
gacaatgaccgccgctcggtcacgctggtgcacaagggcaacatcatgaagttcaccgaa
ggcgcgttccgcgactacggctacgcgctggcgcaaaaggagttcaacgcggaactgatc
gacggcggcccgtggatgaaggtcaagaatccgaagtcgggcaacgacatcgtcgtgaag
gacgtgatcgccgatgccttcctgcagcagatcctgctacgcccggccgaatacgatgtc
atcgccacgctcaacctgaacggcgactacatctcggacgcgctcgcggcgcaggtcggc
ggcatcggcatcgcgccgggggcgaacctgtccgattccgtcgcgatgttcgaagccacg
cacggcaccgcgccgaaatacgcgggcaaggattatgtgaatcccggctcggagattctc
tcggctgaaatgatgctgcgccatctgggctggttcgaggcggcggaccgcatcattgcg
tcgatggagcagtcgattctgtcgaagcgcgtcacctacgacttcgcacgcctgatggaa
ggcgcaacgcaggtctcgtgctcgggattcggcgcggtgatgatcgagaatatgtga

DBGET integrated database retrieval system