KEGG   Burkholderia sp. YI23: BYI23_A006280Help
Entry
BYI23_A006280     CDS       T01711                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00620  Pyruvate metabolism
byi00680  Methane metabolism
byi00710  Carbon fixation in photosynthetic organisms
byi01100  Metabolic pathways
byi01120  Microbial metabolism in diverse environments
byi01200  Carbon metabolism
Module
byi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BYI23_A006280
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_A006280
   00680 Methane metabolism
    BYI23_A006280
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BYI23_A006280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AET88466
UniProt: G8M5Q9
LinkDB All DBs
Position
1:complement(709707..712673)
Genome map
AA seq 988 aa AA seqDB search
MVTKAAKAATAVKASKAAIAPKPAKKAVAAKTVRAKTPRANGTPAPRPASRTRDDKDRPL
FEDIRFLGRLLGEVLREQEGDAVFDVVEAIRQTAVKFRREDDVEASQTLEKKLRALSPEQ
TVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSGSQPGTIAYAIERMREHKNISATRK
MLEKFFGDALIVPVLTAHPTEVSRKSILDAQHDIARLLAERDQELTARERANNAAVLRAR
VTSLWQTRMLRDTRLSVTDEIDNALSYYRATFLAEIPGLYADIEAALAEHGLPVRLPPFF
QMGSWIGGDRDGNPFVTGETLETAITRQAIVIFEHYLEEVHKLGAELSVSNLLAGSSDAL
KALADASPDQSPHRTDEPYRRALIGIYTRLAASARVRLGEGVVSVRSAGPGAPQIRATPY
ADSAEFVRDLHVLVDSLAEHHGESMSILRLSPLVRAAEVFGFHLASIDLRQSSDIHEAVI
SELLARAGVVADYASLSEEQKRDVLLKELAQPRPLRLPYAQYSDLAKSELGVLEAARETR
EKFGARAVRNYIISHTETVSDLLEVMLLQKETGVLHGCLGAKDDSPRDGLMVIPLFETIA
DLRNAPVIMGEFFALPGIDALIENQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVT
LFTARGTTLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFANAEI
GRRNLETVVAATLEASVLPHENAPAQLPQFEAAMQTLSDSAMAAYRALVYETPGFTDYFF
LSTPISEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVT
AYLDKAGSDDERAKRLAMLRKMHKTWPFFKNLLSNMDMVLAKTDLAVASRYAQLVSDKKL
RKLVFDKIVAEHQRTCDVLGEITGKADRLADNPLLARSIKNRFPYLDPLNHLQVELLKRH
RAGDQNVRLRRGIHLTINGIAAGLRNTG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atcgtcacgaaggccgcgaaggccgcaaccgcggtgaaagcgtcgaaagcggccatcgcg
ccgaagccggcgaagaaagccgttgccgcgaaaaccgttcgcgcgaaaacgccgcgcgcg
aacggcacaccggcgccgagacccgcgagccgcacgcgcgacgacaaggaccgcccgctc
ttcgaagacatccgctttcttggccggctgctcggcgaagtgctgcgtgaacaggaaggc
gacgccgtgttcgatgtggtcgaggccatccgtcagacggccgtgaaattccgccgagag
gacgacgtcgaggcctcgcagacgctcgaaaagaagctgcgcgccttgtcgccggaacag
acggtttcggtcgtgcgcgcgttcagctatttctcgcatctcgcgaatatcgcagaagac
cgtcatcacaatcggcgccgccgcattcacgcgctcgccggttccggctcgcagcccggc
acgatcgcctatgcgatcgagcgcatgcgcgagcacaagaacatcagcgcgacgcgcaag
atgctcgaaaaattcttcggcgatgcgctgatcgtgcccgtgctcaccgcgcatccgacc
gaagtgtcgcgcaagagcattctcgacgcgcagcacgacatcgcgcgcctgctcgccgag
cgcgatcaggaactgaccgcccgtgagcgcgccaataacgcagccgtgctgcgcgcgcgc
gtgacctcgctctggcagacgcgcatgctgcgcgacacgcgcctttccgtgaccgatgaa
atcgacaacgcgctgtcttactatcgcgcgacttttctcgcggaaattcccggtctttac
gccgatatcgaagccgcactcgccgagcacggcctgcccgtgcgcctgccgccgttcttc
cagatgggtagctggatcggcggcgaccgcgacggcaatccgttcgtcacgggcgaaacg
ctcgaaaccgcgatcacgcgtcaggcgatcgtgatcttcgagcactatctggaagaggtg
cacaagctcggcgcggaactgtccgtatcgaatctgctggccggttcgagcgatgcattg
aaagcgctcgccgatgcctcgcccgatcagtcgccgcatcgcacggacgagccgtaccgg
cgcgcgctcatcggcatctatacgcggcttgcggcgagcgcgcgcgtgcggctcggcgaa
ggcgtggtttcggtgcgcagcgcgggaccgggcgcgccgcagattcgcgcgacgccctac
gccgattccgccgagttcgtgcgcgatctgcacgtgctggtcgattcgctcgccgagcat
cacggcgagtcgatgtcgatcctgcgtctgtcgccgctcgtgcgcgcggcggaagtcttc
ggcttccatctcgcgagcatcgacttgcggcaaagctcggacatccacgaagccgtgatt
tcggaactgctcgcgcgcgcgggcgtggtcgcggattacgcgtcgctatccgaagagcag
aagcgcgacgtgctgctgaaggaactcgcgcagccgcgtccgctgcgcctgccctatgcg
cagtattccgacctcgcaaagagcgagctcggcgtgctcgaagcggcccgcgagacgcgc
gaaaaattcggcgcgcgcgcggtgcgcaactacatcatctcgcacacggaaaccgtcagc
gacctgctggaagtgatgttgctgcagaaggaaaccggcgtgctacacggctgcctcggc
gcgaaggacgactccccgcgcgacggcctcatggtgatcccgctgttcgagaccatcgcg
gatttgcgcaacgcgcccgtcatcatgggcgagtttttcgcactgccgggcatcgacgcg
ctcatcgagaatcagggcaacgagcaggaagtgatgctcggctattccgacagcaacaag
gacggcggctttctcacgtcgaactgggagctgtatcgcgcggaactggcgctcgtcacg
ctcttcacggcgcgcggcacgacgctgcggctgttccacggccgcggcggcacggtcgga
cgcggcggcggcccgacctatcaggcgattctgtcgcagccgcccggcaccgtcgacggg
cagatccgcctcaccgaacagggcgaagtgatcgcgagcaagttcgccaacgcggagatc
gggcggcgcaatctggagacggtggtcgccgcgacgctcgaagcctcggtgctgccgcac
gaaaacgcgcccgcgcaactgccgcaattcgaagcggcgatgcagacgctttccgactcc
gcgatggccgcgtaccgcgcgctcgtctacgagacgcccggcttcaccgactacttcttc
ctctcgacgccgatttcggaaatcgcggaactgaacatcggcagccggccggcttcgcgc
aagctgcaggaccccaagcagcgcaagatcgaggatctgcgcgcgattccgtggggtttc
tcgtggggacaatgccgtctgctgctcacgggctggtacggcttcggcagcgcggtgacg
gcctatctcgacaaagccggctccgacgatgaacgcgcgaagcgcctcgccatgctgcgc
aagatgcacaagacgtggccgttcttcaagaacctgctgtcgaacatggacatggtgctc
gcgaagaccgatctcgccgtcgcgtcgcgctatgcgcagctcgtcagcgacaagaagctg
cgcaagctcgtcttcgacaagatcgtcgcggagcatcagcgcacgtgcgacgtgctcggc
gaaatcaccgggaaagccgatcgtctcgccgacaacccgctgctcgcgcgctcgatcaag
aaccgcttcccatacctcgatccgctgaatcacctgcaggtggaattgctcaagcgccac
cgcgccggcgatcagaacgtgcggctgcggcgcgggattcacctgacgatcaacggtatc
gcggcgggattgcgcaataccggctga

DBGET integrated database retrieval system