KEGG   Burkholderia sp. YI23: BYI23_A011660
Entry
BYI23_A011660     CDS       T01711                                 

Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
byi  Burkholderia sp. YI23
Pathway
byi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BYI23_A011660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:byi03011]
    BYI23_A011660
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A011660
Ribosome [BR:byi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BYI23_A011660
  Bacteria
    BYI23_A011660
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A011660
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: AET89004
LinkDB
Position
1:1307187..1307558
AA seq 123 aa
MRHYEIVFIVHPDQSEQVPAMIERYKGTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHYV
CMNIECDQATLEELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKAASQPSE
AQA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcgtcattacgaaatcgtctttatcgtgcaccccgatcagagcgagcaagtgcccgcc
atgatcgagcgctacaagggcacgatcacgtcgcacggtggccagatccaccgtatcgaa
gactggggccgccgccaactggcctacatgatcgagaaactcgccaaggctcactacgtc
tgcatgaacatcgaatgcgatcaggccacgctcgaagagctggagcacgcattcaagttc
aacgacgccgtgctgcgtcacctcatcgtcaagatgaagaaggccgaaaccggcccgtcg
ccgatgatgaaggaagtgcagcgcgaagaagccaagaaggcggccagccagccgtccgaa
gcgcaggcttaa

DBGET integrated database retrieval system