KEGG   Burkholderia sp. YI23: BYI23_A017160Help
Entry
BYI23_A017160     CDS       T01711                                 

Definition
(GenBank) short-chain dehydrogenase/reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00061  Fatty acid biosynthesis
byi00780  Biotin metabolism
byi01100  Metabolic pathways
byi01130  Biosynthesis of antibiotics
byi01212  Fatty acid metabolism
Module
byi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BYI23_A017160
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BYI23_A017160
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BYI23_A017160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:byi01004]
    BYI23_A017160
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BYI23_A017160
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BYI23_A017160
Lipid biosynthesis proteins [BR:byi01004]
 Fatty acid synthase
  Component type
   BYI23_A017160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AET89554
UniProt: G8M4S4
LinkDB All DBs
Position
1:1936244..1937041
Genome map
AA seq 265 aa AA seqDB search
MGFLAGKRILLTGLLSNRSIAYGIAEACKREGAELAFTYVGERFKERITEFATEFGSDMV
YPCDVADDAQIEGLFTSLKERWDSLDGLVHSIGFAPREAIAGDFLEGMSRENFRVAHDIS
AYSFPALAKAARPMLKDGSSLLTLSYLGAERALPNYNTMGLAKASLEASVRYMAAAPSLG
GTGVRVNAISAGPIKTLAASGIKGFGKILNFVEENAPLKRNVTIEQVGNVAAFLLSDLAA
GVSAEVVHVDAGFHAVVGGMGAEAE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgctggaaaacgaattctgctgacgggcctgctgtcgaaccgctcgatt
gcgtacggcatcgccgaggcctgcaagcgcgaaggcgcggaactggcgttcacgtatgtc
ggcgagcgcttcaaagagcgcatcaccgaattcgcgaccgagttcggcagcgacatggtc
tacccgtgcgacgtcgccgacgacgcgcagatcgaaggcctcttcacgtcgctcaaggaa
cgctgggactcgctcgacggcctcgtgcactccatcggcttcgcgccgcgcgaagcgatc
gccggcgacttcctcgaaggcatgtcgcgcgagaacttccgcgtcgcgcacgacatctcc
gcctacagcttccccgccctcgcgaaggccgcgcggccgatgctgaaagacggctcgtcg
ctgctcacgctctcctatctcggcgcggaacgcgcgctgccgaactacaacaccatgggc
ctcgcgaaggcttcgctcgaagccagcgtgcgttacatggcggcagcgccgtcgctcggc
ggaaccggcgtgcgcgtgaacgccatttcggccggcccgatcaagacgctcgccgcgagc
ggcatcaagggcttcggcaagatcctgaatttcgtcgaagagaacgcgccgctcaagcgc
aacgtgacgatcgagcaggtcggcaatgtcgcggcgttcctgctgtcggatctggcggcg
ggcgtgagcgcggaagtcgtgcacgtcgatgccggcttccatgcggtcgtcggcggcatg
ggcgccgaggcggaataa

DBGET integrated database retrieval system