KEGG   Burkholderia sp. YI23: BYI23_A018930
Entry
BYI23_A018930     CDS       T01711                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:byi03009]
    BYI23_A018930
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A018930
Ribosome biogenesis [BR:byi03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BYI23_A018930
 Prokaryotic type
  GTPases
   BYI23_A018930
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A018930
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N AIG1 Dynamin_N RsgA_GTPase GTP_EFTU AAA_22 Roc SRPRB ABC_tran AAA_29 PduV-EutP Septin KH_1 Ploopntkinase3
Other DBs
NCBI-ProteinID: AET89731
LinkDB
Position
1:complement(2136944..2137807)
AA seq 287 aa
MVAIVGRPNVGKSTLMNALVGQKVSITSRKAQTTRHRITGINTLDDAQYIFVDTPGFQTR
HSGALNRSLNRAVTSTLTSVDAILFVIEAGRFGPDDQKVLDLIPAGTPTLLIANKLDRVG
DKDSLFPFMQQMSGLRDFREIVPLSAKHPDDVKRLMAVLKPYLPEGEPIYGEDDLTDRSE
RFLAAEILREKVFRWTGDELPYTSTVLIDKFETEGRLRRVFATILVDRDMHKAMIIGQKG
AKLKQISTEARLDMEKLFDGPVYLETFVKVKSGWADNEAGLRAYGYE
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtcgcgatcgtcggccggcctaacgtcggcaagtcgacgctgatgaatgcgctcgtc
ggccagaaggtgagcatcacgtcgcgcaaggcgcagacgacgcgccaccgcatcaccggc
atcaacacgctggacgacgcgcagtacatcttcgtcgatacgcccggcttccagacgcgc
catagcggcgcgctcaaccgctcgctcaaccgcgcggtgacgtcgacgctcacgtccgtc
gatgcgattctcttcgtgatcgaagccggccgcttcggtcccgacgaccagaaagtgctc
gacctgattccggccggcacgcctacgcttttgatcgcgaacaagctcgatcgcgtcggc
gacaaggattcgctctttcctttcatgcagcagatgtcgggcttgcgcgatttccgcgag
atcgtgccgctctcggcgaagcatcccgacgacgtcaagcggctgatggcggtcttgaag
ccgtatctgcccgaaggcgagccgatctacggcgaggacgatctcaccgaccgcagcgag
cgctttctcgccgccgaaatcttgcgcgagaaggtgttccgctggaccggcgacgagttg
ccgtacacgagcacggtgctcatcgacaagttcgaaaccgaagggcgtctgcgccgcgtg
ttcgccacgatcctcgtcgaccgcgacatgcacaaggcgatgatcatcggccagaagggc
gcgaagctgaagcagatcagcaccgaggcgcggctcgacatggagaagctcttcgacggt
cccgtgtatctcgaaaccttcgtcaaggtgaagagcggctgggcggacaacgaggcgggc
ctgcgcgcatacggctacgagtaa

DBGET integrated database retrieval system