KEGG   Burkholderia sp. YI23: BYI23_A019630
Entry
BYI23_A019630     CDS       T01711                                 

Definition
(GenBank) ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
byi  Burkholderia sp. YI23
Pathway
byi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BYI23_A019630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:byi03011]
    BYI23_A019630
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A019630
Ribosome [BR:byi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BYI23_A019630
  Bacteria
    BYI23_A019630
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A019630
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: AET89801
LinkDB
Position
1:complement(2206419..2206673)
AA seq 84 aa
MVIIRLARGGSKKRPFYNIVATDSRSRRDGRFIERVGFYNPVATKGESLRIAQDRLTYWQ
GVGAQLSPTVERLVKQAQQAQPAA
NT seq 255 nt   +upstreamnt  +downstreamnt
atggtcatcatccgcttggctcgtggcggctcgaagaagcgcccgttctacaacatcgtc
gcaaccgattcgcgtagccgccgtgacggccgcttcatcgagcgcgtgggtttctacaac
ccggtcgcgaccaagggcgaatcgctgcgtatcgcgcaagatcgcctgacgtactggcaa
ggcgtcggcgcgcaactgtcgccgacggtcgagcgtctggtcaagcaagctcagcaagcc
cagccggctgcttga

DBGET integrated database retrieval system