KEGG   Burkholderia sp. YI23: BYI23_A024490Help
Entry
BYI23_A024490     CDS       T01711                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:byi03012]
    BYI23_A024490
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A024490
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:byi04147]
    BYI23_A024490
Translation factors [BR:byi03012]
 Eukaryotic Type
  Elongation factors
   BYI23_A024490
 Prokaryotic Type
   BYI23_A024490
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BYI23_A024490
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BYI23_A024490
  Exosomal proteins of breast cancer cells
   BYI23_A024490
  Exosomal proteins of colorectal cancer cells
   BYI23_A024490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C RsgA_GTPase cobW AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: AET90287
UniProt: G8M961
LinkDB All DBs
Position
1:complement(2741709..2742899)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGSFLMPVEDVFSISGRGTVVTGRIERGLVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcggaccaagccgcacgtgaacgtgggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcaatcacgacggtgctgaccaagaagttc
ggcggcgaagccaaggcgtacgaccagatcgacgcggcgccggaagaaaaggcacgtggt
atcaccatcaacaccgcgcacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcaatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgaacacatc
ctgttggcccgtcaggttggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgagctgctcgaactcgtcgaaatggaagtgcgcgagcttttgtcgaag
tacgacttcccgggcgacgacaccccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgaacctggccgacgcactggacacg
tacatcccgacgccggagcgcgcggtggacggttcgttcctgatgccggtggaagacgtg
ttttcgatctcgggtcgcggcacggtggtgacgggtcgtatcgagcgtggcctggtgaag
gttggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacaggc
gtggaaatgttccgcaagctgctggaccaaggtcaagcgggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggccaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgccccgatcgccatggaagaaggtctgcgcttcgcaattcgc
gaaggcggccgtaccgtcggcgccggtgtcgttgcgaagattatcgagtaa

DBGET integrated database retrieval system