KEGG   Burkholderia sp. YI23: BYI23_B003190Help
Entry
BYI23_B003190     CDS       T01711                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BYI23_B003190
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BYI23_B003190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 Glutaredoxin FAD_binding_3 HI0933_like AlaDh_PNT_C DAO K_oxygenase FMO-like NAD_binding_8 DUF2190
Motif
Other DBs
NCBI-ProteinID: AET90926
LinkDB All DBs
Position
2:complement(399717..401303)
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLKAYLEKVTRPIELVAFLDGGDKSRELKSLLDEIASLSTRISVVEKEDASV
RRPSFTIGEPGKPAGIHFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIKNLDGDFA
FETYFSLSCQNCPEVVQALNVMSIINPRIKHVAIDGALFQQEVEAREVMSVPMMFVNGES
FGSGRMGVKEILAKLDTGASARAAKELENKPVFDVLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFISVQETEGPKFATALEQHVKSYEVDVMDVQRADKLVPGRVNE
IHLASGAVLKAKTVILSTGARWREINVPGEREYRGRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLVSAVTLIEFGTELRADAVLQKKLRSLKNVTIVTNAQTTEISGDGKKV
SGIAYTDRATGASHHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSLPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRASVEDEAVVEEEAAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcagttaaaagcgtatttggaaaaagtcacccggccg
atcgaactcgtcgccttcctcgacggcggcgacaagtcgcgcgagctgaaaagcctgctc
gacgaaatcgcctcgctgtccacgcggatcagcgtcgtcgagaaagaggacgccagcgtg
cgtcgtccgtccttcaccatcggcgaaccgggcaagcccgcgggcattcatttcgccggc
atcccgatgggtcatgaattcacgtcgctcgtgctcgccttgctgcagacgggcggccat
ccggtcaagctcgacgacgccaccatcgagcagatcaagaatctcgacggcgacttcgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgatcatcaatccgcgcatcaagcacgtcgcgatcgacggcgcgctcttccag
caggaagtcgaagcgcgtgaggtcatgtccgtgccgatgatgttcgtcaacggcgagagc
ttcggctcgggccgcatgggcgtgaaggaaattctcgcgaagctggacacgggcgcttcg
gcgcgcgccgcgaaggaactggaaaacaagccggtgttcgacgtgctgatcgtcggcggc
ggtccggcgggcgcggcggcggcgatctacgcggcgcgcaagggcatcgccacgggcgtc
gtcgcggagcgcttcggcggccaggtgctcgacacgatggccatcgaaaacttcatctcc
gtgcaggaaaccgaagggccgaagttcgcgaccgcgctggagcagcacgtcaagagctat
gaagtcgacgtgatggacgtgcagcgcgccgataagctcgtgccgggccgcgtgaacgag
attcatctcgcgagcggcgcggtgctgaaggcgaagaccgtgattctctcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcggccgcggcgtggcgtac
tgcccgcattgcgacggcccgctcttcaagggcaaacgcgtggcggtggtcggtggcggc
aattcgggcgtggaagcggcgatcgacctcgcgggcctcgtgtcggcggtcacgctgatc
gagttcggcacggaactgcgcgccgacgcggtgctgcaaaagaagctgcgcagcctgaag
aacgtgaccatcgtcacgaacgcgcagaccacggaaatttccggcgacggcaagaaggtc
agcggcatcgcctatacggaccgcgcgacgggcgcgtcacatcacgtcgaactggaaggc
gtgttcgtgcagatcggtctcgtgccgaacaccgaatggctcaaaggcacggtggagttg
tcgaagcacggcgagatcgtcgtcgatgcgaagggcgcgacctcgctgccgggcgtgttc
gctgcgggcgacgtgaccacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctgtcggcgttcgatcatctgatccgcgcgtcggtggaagacgaagca
gtggtcgaagaagaagcggcggcctga

DBGET integrated database retrieval system