KEGG   Burkholderia sp. YI23: BYI23_B009790Help
Entry
BYI23_B009790     CDS       T01711                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00380  Tryptophan metabolism
byi00630  Glyoxylate and dicarboxylate metabolism
byi01110  Biosynthesis of secondary metabolites
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_B009790
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BYI23_B009790
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BYI23_B009790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AET91586
UniProt: G8MBW9
LinkDB All DBs
Position
2:complement(1124856..1126991)
Genome map
AA seq 711 aa AA seqDB search
MKQTGAPTMATKKQPPPSGVARNNNKKTESLETYRSDATNQALTTNQGVKIADNQNTLRA
GDRGPSLLEDFIMREKITHFDHERIPERIVHARGSAAHGVFKVYESQAELTKAGFLQDPS
KETPVYVRFSTVQGSRGSADTVRDVRGFAVKFYTDEGNFDLVGNNMPVFFIQDAIKFPDF
VHAVKPEPHNEMPQGASAHDTFWDFVSLVPESAHMVLWTMSDRAIPKSLRTMEGFGIHTF
RFINAQGKGRFVKFHWRPTIGSASLLWDEAQKLAGKDSDYHRRDLWEAIDNGDYPEWELG
VQIVEEEDEHKFDFDLLDPTKIIPEELVPLKMIGKLTLNRNPDNFFAETEQVAFCPGHIV
PGIDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPIAPLHNGQRDAMHRQTIDKGQ
ASYEPNSIDGGWPKETAPAAAGGGFESYTERVEGSKIRVRSPSFADHYSQATLFWNSMTE
PEKEHIVGAYSFELSKVERKNIRERQLGILANIDETLAARVADNLGLPTPKKNAGAEELG
KSSVTDSPALSIVAKAKPSVKTRKVAILAAKGADAASIKAVKDALAAEGAHAKVISPTLG
SPAQGVEADATILGMPSIMFDGVIVAGGKESAKVLAQSGDARHFVLEAFKHLKAIGAIGD
GEDVLAAAHLPSSEEGVSVGGDAAKVIKSFIEAMSKHRVWSRAQKAESVPA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
ctgaaacaaaccggagcccccacaatggcaacaaagaagcaacccccgccgagcggcgtc
gcccgcaacaacaacaaaaaaaccgaatccctcgaaacctaccgctccgacgcgaccaac
caagccctgacgacaaaccagggcgtcaagatcgccgacaaccagaacaccctgcgcgcc
ggcgaccgcggcccgtcgctgctcgaagacttcatcatgcgtgagaaaatcacgcacttc
gatcacgagcgcatcccggaacgcatcgtgcacgcgcgaggttccgccgctcacggcgtc
ttcaaggtgtacgaatcgcaggccgagctgaccaaggccggattcctgcaagacccgtcg
aaagaaacgcccgtctatgtgcgcttctcgaccgtgcaaggctcgcgcggctcggccgac
accgtgcgcgacgtgcgcggcttcgcggtcaagttctacacggacgaaggcaacttcgat
ctcgtcggcaacaacatgccggtctttttcattcaggacgcgatcaagtttcccgacttc
gtccacgccgtgaaacccgagccgcacaacgaaatgccgcaaggggcctccgcgcacgac
accttctgggacttcgtctcgctcgtgcccgaatccgcgcatatggtgctctggaccatg
tccgatcgcgccatccccaaaagcctgcgcacgatggaaggcttcggcatccacaccttc
cgcttcatcaacgcgcaaggcaaagggcgcttcgtgaagttccactggcggccgacgatc
ggctccgcgtcgctcttgtgggacgaggcgcaaaagctcgcgggcaaggattcggactac
catcggcgcgatctgtgggaagccatcgacaacggcgactatcccgaatgggaactcggc
gtgcagatcgtcgaggaagaggatgaacacaagttcgacttcgatctgctcgatccgacc
aagatcatccccgaggaactcgtgccgctcaagatgatcggcaagctcacgctgaatcgc
aatccggacaatttcttcgccgaaaccgaacaggtcgcgttctgtccggggcatatcgtg
ccgggcatcgacttcacgaacgatccgctgctgcaaggccggcttttctcctacaccgat
acgcagatcagccgtctcggcggcccgaacttccacgaaattccgatcaaccgtccgatc
gcgccgctgcataacggccagcgcgacgcgatgcatcggcagacgatcgacaagggtcag
gcgtcctacgaaccgaattcgatcgacggcggctggcccaaggaaaccgctccggcggcg
gcaggcggcggcttcgagagctacacggagcgcgtcgaaggctcgaagatccgcgtgcgc
agcccgtcattcgccgatcactactcgcaggcgacgctcttctggaacagcatgaccgag
ccggaaaaggagcatatcgtcggggcgtattcgttcgagctttccaaggtcgagcgcaag
aatatccgcgagcggcagctcggcattctcgccaatatcgacgaaacgctcgccgcgcgc
gtcgccgacaatctcgggctgcccacgccgaaaaagaacgcgggcgcggaagaactcggc
aagtcatccgtgacggactcgcccgcgctgtcgatcgtcgcgaaggcgaagccttcggtg
aagacgcgcaaggtcgcgattctcgccgcgaagggcgcggacgccgcgagcatcaaggcc
gtcaaggacgcgctcgccgccgagggcgcgcacgccaaggtcatctcgccgacgctcggc
tcgcccgcgcaaggcgtcgaagccgatgcgacgattctcggcatgccgtcgatcatgttc
gacggcgtgatcgtcgcgggcgggaaggagagcgcgaaggtgctcgcgcaatccggcgac
gcgcgccacttcgtgctggaagcgttcaagcatctgaaagcgatcggcgcaatcggcgac
ggtgaagacgtgctcgcggccgcccatctgccgagcagcgaagagggcgtttcagtcggc
ggcgacgcggcgaaggtgatcaaaagcttcatcgaagcgatgagcaagcatcgcgtctgg
tcgcgcgcgcaaaaggcggagtcggttccggcctga

DBGET integrated database retrieval system