KEGG   Burkholderia sp. YI23: BYI23_B009980Help
Entry
BYI23_B009980     CDS       T01711                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00250  Alanine, aspartate and glutamate metabolism
byi00410  beta-Alanine metabolism
byi00640  Propanoate metabolism
byi00650  Butanoate metabolism
byi01100  Metabolic pathways
byi01120  Microbial metabolism in diverse environments
Module
byi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BYI23_B009980
   00650 Butanoate metabolism
    BYI23_B009980
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BYI23_B009980
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BYI23_B009980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:byi01007]
    BYI23_B009980
Enzymes [BR:byi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BYI23_B009980
Amino acid related enzymes [BR:byi01007]
 Aminotransferase (transaminase)
  Class III
   BYI23_B009980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 TERF2_RBM
Motif
Other DBs
NCBI-ProteinID: AET91605
UniProt: G8MBY8
LinkDB All DBs
Position
2:1148190..1149473
Genome map
AA seq 427 aa AA seqDB search
MKNAALQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVCNTGHRHPK
IVEAIRAQLDCFTHTAYQIVPYESYVSLAEKISARAPSTYPNKTAFFTTGAEAVENAVKI
ARVATGRPGVIAFTGGFHGRTLMGMALTGKVMPYKIGFGPFPSDVFHAPFPNELHGVSVD
DSLRALEHLFKADIDPTRVAAIIFEPVQGEGGFNPAPVEFVRGLRRICDELGILLIADEV
QTGFARTGKLFAMEHYDVVPDLMTIAKSLAGGMPLSGVVGRADIMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEEALCERAVVLGDKLKAKLESLRRDVPQIADVRGPGAMIAVEFCT
PGSNDADAAFAKLVQTRALERGLLLLVCGVYSNVVRFLFPLTIQDQVFDEALGILEEVLM
ESVGVAV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaaacgccgccctgcaagcccgcaagaatgccgcgaccccgcgcggcgtcggcgtg
atgtgcgatttctacgcggcgcgggccgaaaacgcggaactgtgggacgtcgagggccgg
cgcttcatcgatttcgcggcgggcatcgcggtatgcaacacggggcatcgtcatccgaag
atcgtcgaggccatccgcgcgcagctcgactgcttcacccacaccgcgtatcagatcgtg
ccgtacgaatcgtatgtgtcgctcgcggaaaagatctccgcgcgcgcgccgtccacgtat
ccgaacaagaccgcgtttttcacgaccggcgcggaagccgtcgagaacgcggtgaagatc
gcgcgagtcgcaacgggccgtccgggcgtgattgccttcacgggcggctttcacggccgc
acgctgatgggcatggcgctgaccggcaaggtcatgccgtacaagatcggcttcgggccg
ttcccgtcggacgtgtttcacgcgccgtttcccaatgagctgcacggcgtgtcggtggac
gattcgctgcgcgcgctcgagcatctgttcaaggccgatatcgacccaacgcgcgtcgcg
gcgatcatcttcgaacccgtacagggcgaaggcggctttaatccggcgccggtcgaattc
gtgcgcggcctgcgcaggatttgcgacgagcttggcattctgctcatcgccgatgaagtg
cagaccggcttcgcgcgcaccggcaagcttttcgcgatggagcactacgatgtcgtcccc
gatctgatgacgatcgcgaagtcgctggcgggcggcatgccgctgtcgggcgtcgtcggg
cgcgcggacatcatggacgcggcggcccccggcggtctcggcggcacgtatgcgggcaat
ccgctggcggtggcggcggcgcacgcggtgctcgacatcatcgacgaggaagcactgtgc
gaacgcgctgtcgtgctgggcgacaagctcaaggcgaaactcgaatcgctccggcgcgat
gtgccgcagatcgcggatgtgcgcgggcctggtgcgatgatcgccgtcgagttctgcacg
ccgggttctaatgatgcggatgctgcgtttgccaagctcgtgcagacgcgcgcgctggag
cgcgggttgttgctgctcgtgtgtggggtgtattcgaacgttgttcggttcttgtttccg
ctcacgattcaggatcaggttttcgatgaggctttggggattcttgaagaggttttgatg
gagagtgttggcgtggcggtttga

DBGET integrated database retrieval system