KEGG   Burkholderia sp. YI23: BYI23_B014310Help
Entry
BYI23_B014310     CDS       T01711                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00630  Glyoxylate and dicarboxylate metabolism
byi00710  Carbon fixation in photosynthetic organisms
byi01100  Metabolic pathways
byi01120  Microbial metabolism in diverse environments
byi01200  Carbon metabolism
Module
byi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_B014310
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_B014310
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BYI23_B014310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AET92038
UniProt: G8MDQ7
LinkDB All DBs
Position
2:1655175..1655591
Genome map
AA seq 138 aa AA seqDB search
MHITQGTFSFLPQLTDDEISSQINYALDQGWSCSIEYTDDPHPRNTYWEMWGLPMFDLHD
AAGVLMEVNECRKTYPNHYIKVNAFDSVRGFETMRLSFMVNRPKEEQGFRLERQDNRSRI
QRYAIRTYATDRPSGERY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcacataacccaaggaaccttctccttcctcccgcaattaaccgatgacgagatatcg
tcacaaatcaactacgccttagaccaaggctggtcgtgctcaatcgaatacaccgacgat
ccccacccaagaaacacctattgggaaatgtggggcctccccatgttcgacctccacgat
gccgccggcgtgctgatggaagtgaacgaatgccgcaagacgtatccgaaccactacatc
aaggtcaacgccttcgattcggtgcgcggcttcgaaacgatgcgtctctcgttcatggtc
aaccggccgaaagaagagcaaggcttccgcctcgaacgccaggacaacagaagccgcatc
cagcgctacgcgatccgcacctacgcaaccgatcgcccgagcggcgagcgctattga

DBGET integrated database retrieval system