KEGG   Burkholderia sp. YI23: BYI23_C004790
Entry
BYI23_C004790     CDS       T01711                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00970  Aminoacyl-tRNA biosynthesis
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BYI23_C004790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_C004790
Enzymes [BR:byi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BYI23_C004790
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BYI23_C004790
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_C004790
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AET92625
LinkDB
Position
3:complement(563431..564864)
AA seq 477 aa
MDAVALAKAVRTRELSAVEVVDAHLARMDAVEPSIHAFCTVTAQSARDAAREVDARISRG
DEVGVLAGVPVGIKDLVCTAGIRTASGSPAYKDFVPDEDDVVVERLKKADAIIVGKTNVP
EFGYSGVGHNPVFETTRNPWNTAMTPGGSSAGSGAAVASGEVPFAIGSDGGGSIRIPSAH
SGIYGIKPSMGRVPLYPGCRDERYPGVSSWESLEHLGPMSRTVADSALMLSVIAGPDPRD
RHSLPHAGFDWTKALDGDLKGLRVAYSPDWGYAAVDPQVRKVVDEAVRVFERDLGCTVEV
AHPGWSDPFDAFWAIVAMDTDLKGMRAMVEQYGEQMSPHLVAFLNHPWSAEDFTNASVTR
KALVNRMWRFMANYDLLLTPTLSVPPFPVHMQGPEIIDGRMVAPTQWLSFTYPINLTGQP
AASVPAGFTADGLPIGLQIVGRHLDDPLVLRASAAFEKARPWRQACPPLLKELGLAN
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggacgcggtcgcgcttgccaaggcggtacgaacgagggagctatcggcggtcgaagtc
gtcgatgcgcatctcgcgcggatggacgcggtcgagccgtcgattcatgcgttctgcacc
gtgacggcgcaaagcgcccgtgacgcggcgcgcgaggtggacgcgcgcatctcgcgcggc
gacgaggtcggcgtgctggcgggcgtgccggtcggcatcaaggatctggtgtgcacggcg
ggcattcggaccgcgtcgggctcgccggcctacaaggacttcgtgcccgacgaagacgat
gtcgtggtcgaacgcctgaagaaagcggacgcgatcatcgtcgggaagaccaacgtgccg
gagttcggttatagcggcgttggtcacaacccggtcttcgaaaccacgcgcaatccgtgg
aatacggcgatgacgccgggcggctccagcgccggctccggcgcggccgtggcgagcggc
gaggtgccgttcgcgatcggcagcgatggtggcggctcgatccgcattccgtcggcacat
tcgggcatctacggcatcaagccgtcgatgggccgcgtgccgctgtatcccggctgccgc
gacgagcgctatccgggcgtgtcgagctgggagagcctggagcatctcggcccgatgagc
cgcaccgtcgccgacagcgcgctgatgctatccgtgatcgccggtcccgatccgcgcgat
cgccattcgctcccgcacgccggattcgactggacgaaggcgctcgacggcgatctcaag
ggcttgcgcgtcgcctatagcccggactggggctacgcggcagtcgatccgcaagtgcgc
aaagtggtggatgaggccgtgcgcgtgttcgagcgcgacctcggctgcacggtcgaagtc
gcccacccgggctggagcgatccgttcgacgcgttctgggccatcgtcgcgatggacacc
gatctcaaaggcatgcgcgcgatggtcgagcaatacggcgaacagatgtcgccgcatctg
gtcgcctttctgaatcatccgtggagcgcggaagacttcaccaacgccagcgtcacgcgc
aaggcgctcgtcaaccggatgtggcgcttcatggcgaactacgacctgctgctcacgccg
acgctgtcggtgccgccgtttcccgtacacatgcagggcccggaaatcatcgatggacga
atggtcgcgccgacgcagtggctctcgttcacctatccgatcaatctgaccggacagccg
gccgcatccgtgcccgcgggattcacggctgacggcttgccgatcgggctgcagatcgtc
ggccggcatctggacgatccgctcgtgctgcgcgcttccgctgcattcgagaaggcgcgg
ccgtggcgtcaggcatgtccgccgttgctgaaggaactcgggctcgccaactga

DBGET integrated database retrieval system