KEGG   Burkholderia sp. YI23: BYI23_C010580Help
Entry
BYI23_C010580     CDS       T01711                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00564  Glycerophospholipid metabolism
byi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BYI23_C010580
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BYI23_C010580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AET93204
UniProt: G8MHY7
LinkDB All DBs
Position
3:complement(1242127..1243731)
Genome map
AA seq 534 aa AA seqDB search
MAASCARTARRSRADMHSTTPPERASLLRELDRTAVFDVVVIGGGASGLGTAVDAASRGY
RTLLLEARDFAKGTSSKATKLVHGGVRYLAQGNVPLVREALRERGLLARNAPHLVRPLGF
IVPAYRTADRLLYGAGLKIYDWLAGSLNLAASRSLGLAETREKSPMLADHLHGHALRGGT
LYYDGQFDDARLAITLMRTLFDLGGIALNNAAVRGVRFDRGEGCHRVAVEDVETGDVLDV
GARCLVNATGVWVDSIRAMADPAARPIVAPSQGVHLTLPSRFLQSRDAILVPRTEDGRVL
FVVPWHGHTIVGTTDTPRRDLPLDPRASDEDINFILATAADYLSVKPTRDDVLSVWAGLR
PLVKGDADASTAALSREHTIETNATGMITVTGGKWTTYRLMAQQVVDLAVSNGLLSAAPC
RTASLPLHGATAQQGGRYGADAEFIARLPGADRVLVQASGLTEAQTRFAVRAELARSVED
VLARRDRALFLDAAEARRAAPDVARIVAEELGRSATWEAEEAARFDAFARGWML
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttcgtgcgcaaggacggcacgccgatcacgcgctgacatgcattcgacgact
ccacccgagcgcgcatcgctgctgcgcgaactggaccgcacggcggtcttcgatgtcgtc
gtgatcggcggcggggcgagcggcctcggcacggccgtcgatgcggcgtcgcgcggctac
cgcaccttgctgctggaagcgcgcgatttcgccaaaggcacgtcgagcaaggccacgaag
ctcgtgcacggcggcgtgcgctatctcgcgcagggcaatgtcccgctggtgcgcgaggcg
ttgcgcgagcgcggcctgctcgcgcgcaatgcgccacatctggtgcgcccgctgggcttc
atcgtgcccgcctaccggaccgccgacaggctgctctacggcgcggggctcaagatctac
gactggctcgcgggttcgctcaatctcgccgcgagccgcagcctcggtctcgccgaaacg
cgcgaaaaatcgccgatgctcgcggaccatctgcacggccacgcgttgcgcggcggcacg
ctctactacgacggccagttcgacgacgcgcgtctcgccatcacgctgatgcgcacgctc
ttcgatctcggcggcatcgcgctgaacaatgcggcggtgcgcggcgtgaggttcgatcgc
ggcgaggggtgtcatcgggtcgcggtggaagacgtcgaaacgggcgatgtgctcgacgtc
ggcgcgcgctgcctcgtcaacgcgacgggcgtatgggtcgattcgatccgcgccatggcc
gatcccgccgcgcggccgatcgtggcgccgagccagggcgtgcatctcacgttgcccagc
cgcttcctgcaaagccgcgacgcgattctcgtgccgcgcacggaagatggccgcgtgctg
ttcgtcgtgccgtggcacgggcacacgatcgtcggcacgacggacacgccgcgtcgcgat
ctgccgctcgatccgcgcgcgagcgacgaggacatcaacttcattctcgcgacggcggcc
gattatctctcggtgaaacccacacgcgacgatgtgctgagcgtgtgggccggtttgcgt
ccgctcgtgaagggcgacgccgatgcctcgacggcggcgctttcgcgcgagcacacgatc
gaaacgaacgcgacgggcatgatcaccgtgacgggcggcaagtggacgacgtatcggctg
atggcgcaacaggtggtcgatcttgccgtcagcaacggcctgttgtccgccgcgccgtgc
cgcacggcctcgctgccgctgcacggcgcgacggcgcagcagggcggccgatacggcgcc
gatgccgagttcatcgcgcgattgccgggcgcggaccgcgtgctcgtgcaggcgagcggg
ctgacggaggcgcagacgcgcttcgcggtgcgcgcggagcttgcgcgctcggtggaagac
gtgctcgcgcgccgcgatcgcgcgctctttctcgacgccgcagaggcgcgccgcgccgcg
ccggacgtggcgcggatcgtcgcggaggaactgggacgcagcgcgacgtgggaagcggag
gaagccgcgcgtttcgacgccttcgcgcggggctggatgttgtga

DBGET integrated database retrieval system