KEGG   Burkholderia sp. YI23: BYI23_D005810Help
Entry
BYI23_D005810     CDS       T01711                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
byi  Burkholderia sp. YI23
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AET94091
UniProt: G8MMQ2
LinkDB All DBs
Position
byi_1p:675957..677435
Genome map
AA seq 492 aa AA seqDB search
MQATERTIPLRHPDAFYIDGHWMPAPHSDTFEVLDCSTEHVAAHVARADAEIAARAIDAA
RRAFDHGPWPRMTPGERSVYLEKIAQRLEAANDAFAHGWSIESGILQRIAKPRIGQFLGA
AFRQYAAMAETYPFVEPRRSATGHQAYAVKEPAGVVLAIVPWNGPAALLAYKVAPALLAG
CTVVVKPSPEAPTSAYLFAQICDEIGLPPGVVNVLTADRDVSETMVRNPAVDKITFTGST
SAGRSISEAAAGRIARVTLELGGKSAALVLDDYDIDAAAQALGQPYFSYLTGQVCHSLTR
IIVPRAKHDTMVEALSAAARAMVPGDPFDDGTTVGPLATARQRDTVERYVAKGIAEGATL
AAGGARPRHLSRGFFFEPTVFGNVDSRAAIAQEEIFGPVLSVIAADSEAHAIELANDSIF
GLNAVVFTSDAGRALNVARRLRTGSVGHNASRTDFSIGFGGFKQSGIGREGGVEGLNAFV
ESKTIVLDQPLA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaccgaacgaacgattccgctgaggcatcccgacgccttctacatcgatggc
cattggatgcccgcgccccactccgacaccttcgaggtgctcgactgcagcacggaacac
gtcgcggcgcacgtcgcgcgagccgatgcggaaatcgccgcacgcgcaatcgacgccgcg
cgccgcgccttcgaccatgggccatggccgcgcatgacgcccggcgagcgctcggtctat
ctggaaaaaatcgcgcaacgcctggaagcggcgaacgacgcgttcgcgcacggctggagc
atcgaatcgggcatccttcaacggatcgccaaaccgcgcatcggccagtttctcggcgcg
gcgtttcgccagtacgccgcgatggccgagacgtatccgttcgtcgaaccgcgccggtca
gccaccggacaccaggcttacgcggtgaaggaaccggccggcgtggtactcgcgatcgtt
ccctggaacggtcctgccgcgctgctcgcctacaaggtcgcgccggcgctgctcgcgggc
tgcacggtcgtcgtcaagccgtcgccggaagcgcccacgtcggcgtatctgttcgcgcag
atctgcgacgagatcggcttgccgcccggtgtcgtcaacgtcctgacggccgaccgcgac
gtttccgaaacgatggtccgcaatccggcagtcgacaagatcacctttaccggctccaca
tcggctggccgcagcatcagcgaggcggcagccggccggatcgcgcgcgtcacgctggaa
ctgggcggcaaatcggcggcgctcgttctcgacgattacgacatcgacgcggcggcccag
gcactcggccaaccgtacttcagctatctgaccgggcaggtgtgccacagcctgacgcgc
attatcgttccgcgcgcgaagcacgacaccatggtggaagcgttgagcgcggccgcgcgt
gcgatggtgcccggcgatcccttcgacgacggcacgacggtcggcccgcttgcgaccgca
cgccagcgcgacaccgtcgagcgctacgtggccaagggcatcgccgaaggtgcgacgctc
gcggccggcggtgcgcgtccgcgccacctgtcgcgtggcttctttttcgagccgactgtg
ttcggaaatgtcgacagccgggcggccatcgcgcaggaagagatcttcggaccagtgctc
tcggtgatcgccgcggacagcgaagcgcatgcgatcgaactcgccaacgattccatcttc
gggctgaacgccgtggtgtttacgtccgacgccgggcgtgcactgaatgtggcacggcgg
ctgcgcaccggcagtgtcggccataacgcgtcgcgcaccgacttttccatcggcttcggt
ggattcaagcaatccggtatcgggcgcgaaggcggcgtcgaagggctgaatgcgttcgtc
gaatcgaagacgatcgtgctcgatcagccgctggcataa

DBGET integrated database retrieval system