KEGG   Burkholderia sp. YI23: BYI23_D008400Help
Entry
BYI23_D008400     CDS       T01711                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BYI23_D008400
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BYI23_D008400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AET94350
UniProt: G8MNG1
LinkDB All DBs
Position
byi_1p:complement(958247..959320)
Genome map
AA seq 357 aa AA seqDB search
MADEQMTAIVCRAPKDYRVERVQRPRAARNEVVIRIAACGICASDCKCWSGAKMFWGGPN
PWVKAPVIPGHEFFGYVEELGEGAEEHFGVKKGDRVIAEQIVPCAKCRYCKSGEYWMCEV
HNIFGFQREVADGGMAEYMRFPPTAIVHKIPDGISLEDAAIIEPLACAIHTVNRGDIQLN
DVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADITINPKTDDALETI
RSITDRYGCDVYIETTGVPAGVSQGLELIRKLGRFVEFSVFGADTTVDWSIIGDRKELDV
RGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFTLDEWDEAIKIANSLDSIKVLLKPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaacaaatgacggcgatcgtatgccgcgcgccgaaagattatcgtgtggaa
cgcgtgcagcgcccgcgtgccgcgcgaaacgaagtcgtgattcgcatcgccgcatgcggc
atttgcgcgagcgattgcaaatgctggtcgggcgcgaagatgttctggggcggcccgaat
ccgtgggtgaaagcgccggtgattccggggcatgaattcttcggttatgtggaagagcta
ggcgaaggcgccgaagaacatttcggcgtgaaaaagggcgaccgggttatcgccgagcag
atcgtgccgtgcgcgaaatgccgctattgcaaatcgggcgaatactggatgtgcgaggtc
cataacatcttcggctttcagcgcgaagtggccgatggcggcatggccgaatacatgcgc
tttccaccgacggccatcgtccataagattcccgacggcatttcgctggaagacgcggcg
atcatcgagccgctcgcatgcgcgattcatacggtgaatcgcggcgatatccagttgaac
gatgtcgtcgtgatcgcgggagcggggccgctcgggctgatgatgacgcaggtcgcgcat
ctcaagacgccgaagaaactcgtcgtgattgatctcgtcgaggaacgtcttgcgctggcg
cgcgaatatggcgcggatatcacgatcaatccgaagaccgacgacgcgctggaaacgatt
cgctcgatcacggatcgctacggctgcgatgtgtatatcgaaacgacgggtgtgccggcg
ggcgtgtcgcaagggctggagttgatccgcaagctcggccgcttcgtcgagttctcggtg
ttcggcgccgatacgacggtggactggtcgatcatcggcgatcgcaaggaactcgacgtg
cgcggtgcgcatctcgggccgtattgctatcccattgcgatcgatctgctcgcgcgtggc
ctggtgacgtcgaagggcatcgtcacacacggctttacgctcgatgaatgggacgaggcg
atcaagattgcgaattcgctcgactcgatcaaggtgctgctcaagccgaagtga

DBGET integrated database retrieval system