KEGG   Burkholderia sp. YI23: BYI23_D008660Help
Entry
BYI23_D008660     CDS       T01711                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like domain family
Organism
byi  Burkholderia sp. YI23
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Csm4_C Pyr_redox_2 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AET94376
UniProt: G8MNI7
LinkDB All DBs
Position
byi_1p:987065..988102
Genome map
AA seq 345 aa AA seqDB search
MKVIAFESIDKPLRLAERPVPAPAADSLTVRVHACGICGSDLHAAQTPGMLREGSVLGHE
FAGEVVEVGADAGADWRAGDRIVALPLRACGTCAPCRDGRLASCEAPATQGFNPALPGAY
AEYASCQAVMAMKIPDTMSYDEAAMIEPFAVALNAYKMAKVPPGADVLIVGAGVIGLAIA
TWARFFGAGDIAISDLVPERLARARDAGAEILIDASNVADPVAELRRATGRPPMFIFECV
GRPILQKLINMAPPKAHLVIAGACLDPEKVSVLSATIKRLRVSFAFTYEREDFEFSLRML
ADGRIRATPFISSVIGLDEVPATFEALKKPNTHCKVMIRNQASAA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcatcgcctttgaaagtatcgacaagccgctcaggctggcggagcggcccgtt
cccgcccccgccgcggacagcctcacggtcagagttcacgcctgcggcatctgcgggtcc
gatctgcacgccgcgcagacgcccggcatgttgcgcgaaggctccgtgctgggtcacgag
ttcgctggggaagttgtcgaagtcggcgcggacgcgggcgcggactggcgcgcgggcgac
cggatcgtggcgctgcccttgcgcgcgtgcgggacatgcgcgccgtgccgcgacggacgt
ctggcgtcgtgcgaagcgcccgcgacgcagggcttcaaccccgcattgccgggcgcgtac
gcggaatacgcctcatgccaggccgtcatggcgatgaagatccccgacacgatgagctac
gacgaagcggcgatgatcgagccgttcgccgtcgcgctcaacgcgtacaagatggcgaag
gtgccgccgggcgcggacgtgctgatcgtcggcgcgggcgtgatcgggctggccatcgcg
acgtgggcgcgctttttcggcgcgggcgacatcgcgatcagcgatctcgtgcccgagcgg
ctcgcacgcgcgcgcgacgcgggcgcggaaatactcatcgacgcgtcgaatgtcgcggac
ccggtcgccgagctacgccgcgcgaccggccgcccgccgatgttcatcttcgagtgcgtc
ggccggccgatcttgcagaagctcatcaacatggcgccgccgaaggcgcatctggtgatc
gcgggcgcgtgcctcgatcccgaaaaggtgtcggtgctgagcgcgacgatcaaacggctg
cgcgtgagtttcgcatttacctacgaacgtgaggacttcgaattttcgttgcgcatgctg
gcggacgggcgcatccgcgcgacgccgttcatttcgtcggtgatcggtctcgacgaggtt
ccggccaccttcgaagcgctcaagaagccgaacacgcactgcaaagtcatgatccgaaat
caggcatcggctgcatga

DBGET integrated database retrieval system