KEGG   Burkholderia sp. YI23: BYI23_D009060Help
Entry
BYI23_D009060     CDS       T01711                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00620  Pyruvate metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_D009060
   00620 Pyruvate metabolism
    BYI23_D009060
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BYI23_D009060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AET94416
UniProt: G8MNM7
LinkDB All DBs
Position
byi_1p:complement(1035383..1036903)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLSTEYPYKKQYGNFIGGKWVPPAGGEYFDNISPITGEPFTSIPRSREADIEA
ALDAAHAAKAAWGRTSVTDRANLLLKLADRMEQNLARLAVAESIDNGKPLRETMAADIPL
AIDHFRYFASAARSQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLEVIEGILPPGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLNADDSFFDKALEGFTMFALNQGEV
CTCPSRALVQESIYERFMERALKRVAAIAQGHPLDTKTMIGAQASREQLEKILSYIDLGK
QEGAQCLSGGERAAFDGELANGYYVKPTVFKGHNKMRIFQEEIFGPVLSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNMLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcagtttctgagcaccgaatatccgtataaaaagcagtacggc
aacttcatcggcggcaagtgggtcccgcccgcgggcggcgagtatttcgacaacatctcg
ccgatcacgggcgaacctttcacgtcgattccgcgctcgcgcgaagccgacatcgaagcc
gcgctcgacgccgcgcatgcggccaaggctgcgtggggccggacctccgtcaccgatcgc
gcgaacctgctgctcaagctcgccgatcgcatggagcagaatctggcgcggctcgcggtg
gccgaatccatcgacaacggcaagccgctgcgcgagaccatggccgcggacattccgctc
gcgatcgatcacttccgctacttcgcgagcgcggcgcgttcgcaggaaggcggcatttcg
gagatcgatcacgatacggtcgcgtatcacttccatgagccgctcggcgtcgtcgggcag
atcattccgtggaatttcccgattctgatggccgtatggaagctcgcgcccgcgctcgcg
gcgggcaactgcgtcgtgctgaagcccgcggagcaaacgcccgcgtcgattctcgtgctg
ctcgaagtgatcgaaggcattctgccgccgggcgtgctcaatgtcgtgaatggcttcggt
ctggaagcgggcaagccgctcgcgtcgaacaagcgcatcgcgaagatcgcattcaccggc
gagaccacgacgggccggctcatcatgcagtacgcgagccagaacctgattccggtcacg
ctggaactgggcggcaagagcccgaatatcttcttcgaggacgtgctgaacgccgacgac
agcttcttcgacaaggcgctcgaaggcttcacgatgttcgcgttgaatcagggcgaagtg
tgcacgtgcccgtcgcgcgcgctggtgcaggaatcgatctacgagcgcttcatggaacgg
gcgctcaagcgcgtcgcggccatcgcacagggccatccgctcgatacgaagacgatgatc
ggcgcgcaggcttcgcgggagcagctcgaaaagatcctgtcgtatatcgatctcggcaag
caggaaggcgcgcaatgtttgagcggcggcgagcgcgccgcgttcgacggcgagcttgcg
aacggctattacgtcaagccgaccgtcttcaaaggccacaacaagatgcgcattttccag
gaggaaatcttcgggccggtgctttcggtgacgaccttcaagaccgaagaagaagccctc
gagatcgcgaacgacacgctctacggtctcggcgcgggcgtgtggacgcgcgacggcacg
cgtgcctaccgcttcggccgcgcgattcaggcgggccgcgtgtggaccaattgctatcac
gcttatccggcgcacgcggcgttcggcggctacaagcagtcgggcatcggacgcgagaat
cacaagatgatgctcgatcattatcagcaaacgaagaacatgctcgtcagttatagcgac
aagccgctcggcttcttctaa

DBGET integrated database retrieval system