KEGG   Blautia sp. YL58: A4V09_04265Help
Entry
A4V09_04265       CDS       T04458                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
byl  Blautia sp. YL58
Pathway
byl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:byl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A4V09_04265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:byl03400]
    A4V09_04265
Enzymes [BR:byl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A4V09_04265
DNA repair and recombination proteins [BR:byl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A4V09_04265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANU75047
UniProt: A0A1C7I5S8
LinkDB All DBs
Position
complement(941782..942714)
Genome map
AA seq 310 aa AA seqDB search
MIDFETKNIKPMLIGQEGNPFDDDRYIYELKWDGERCIAYLDPSGKTELRNKRNEKMLPK
VPELKELWRQAGEKCILDGELMVLKNGRPDFFEIQRRSLTANKFKIELASKQFPATFVAF
DILYYKDRDVTALPLLERKVLLQKTFSESERLVLSRYVEGNGTAFYQMAEQQELEGIVAK
KKDSLYIQDKRTKDWIKIKRMLDDDFIICGYIQKQNNMISLVLGKYKDHVIVYEGHVTMG
VGADTLEQLLKLPSGYPPANTPSGHGNKEAVWVQPKLVGVVKYMPRVGSDGRHQSVFKGL
RYDKRPEECL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgaaacaaaaaacatcaaaccaatgctcattggacaagagggaaatccg
tttgatgatgataggtatatttatgaattgaaatgggacggggaaagatgcattgcctat
ttggacccaagcggcaaaacagagttgagaaataagcgtaatgaaaaaatgttaccaaaa
gtaccggaattaaaagaattatggagacaggccggagaaaaatgcattctcgacggcgaa
ctgatggtactgaaaaatggcaggcctgacttctttgagatccaacgccgcagtcttaca
gcgaataaatttaaaattgaacttgcgtcaaagcagtttcctgctacattcgttgcgttt
gatatcttatattataaggacagggatgtaacagctctgccattactggagagaaaggtt
cttttacagaaaaccttttcggaatccgaacggttggtcttatcaagatatgtggaaggc
aatggaaccgccttttatcagatggcagaacagcaggaattagaaggcatagttgccaaa
aaaaaggacagtctctatatacaggataaacgcacgaaggactggataaaaataaaacgg
atgctggatgatgattttattatctgtggttatatccaaaagcaaaataatatgatcagt
cttgttctggggaaatataaagatcatgtgatcgtctatgaaggacatgtgacaatgggg
gtaggagccgatacgttagaacagctgctaaaattgccatccggttatccccccgccaat
acaccaagcggtcatggaaataaggaggcagtctgggtgcagccaaaattagtaggtgta
gtgaaatatatgcccagagtagggagtgacggaagacatcaatctgtcttcaaagggctg
agatatgataaacgtccggaagaatgtctgtaa

DBGET integrated database retrieval system