KEGG   Blautia sp. YL58: A4V09_12485Help
Entry
A4V09_12485       CDS       T04458                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
byl  Blautia sp. YL58
Pathway
byl00030  Pentose phosphate pathway
byl01100  Metabolic pathways
byl01110  Biosynthesis of secondary metabolites
byl01120  Microbial metabolism in diverse environments
byl01130  Biosynthesis of antibiotics
byl01200  Carbon metabolism
byl01230  Biosynthesis of amino acids
Module
byl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
byl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:byl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4V09_12485
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    A4V09_12485
Enzymes [BR:byl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     A4V09_12485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ANU76515
UniProt: A0A1C7IA88
LinkDB All DBs
Position
complement(2661309..2662241)
Genome map
AA seq 310 aa AA seqDB search
MAEFKGTREAFAAALIDLAANDHKIMFVSPDSLKAMRATKFAELYPDQYVEVGISEQNAV
DTAAGLAAAGLTPFVGTYAGFMTMRACEQMRTFVAYPNLNVKFVGINSGLLGGEREGVTH
QFYEDLGILSNIPNYTILTPADGYQTYKAVQMAAEINGPVYVRAGSGREANVYEKDAPFS
PEGITILREYGDDTLLLSSGFVLERVLAAADLLKEQGVNVTVGDINILYGKNPEKIVEAI
KKAKKIVTVEDHNVNGGLGAYISKLATEYAPKFVIRMGLTTFGESGPAKELADFYGFSPE
NIAKTVKENL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttaaggggacgagagaggcctttgctgctgcacttattgatctggcagca
aatgaccataaaatcatgtttgtttcacctgactcattaaaagcaatgcgtgccacaaag
tttgcagaactgtatcctgaccagtatgtggaggtggggatatccgagcagaatgcagtg
gatacggcggcaggactggcggcagcaggattaaccccgtttgtaggcacttacgcggga
tttatgaccatgcgcgcctgtgaacagatgcggacatttgtggcatatcccaacctgaat
gtaaagtttgtgggcatcaactccgggcttctgggaggggagagagagggggttacccat
cagttttatgaggacctggggattctctccaatataccgaattatacgatcctgacaccg
gcggatggatatcagacatataaagcggtacagatggcagcagagatcaacgggccggta
tatgtcagggccggaagcggaagagaggcaaatgtgtacgaaaaagacgcaccattctcc
ccggagggaattactatcctgagagaatacggagatgacacactccttttgtccagcggt
tttgtactggaacgtgttctggccgcggcggacctgctaaaggaacagggtgtgaatgtg
acagtgggagatatcaacattttatatggaaagaacccggagaaaatagtggaagcgatc
aaaaaagcgaaaaagatcgtgactgtggaagatcataatgtgaacggcggtctgggggca
tacataagcaagctggcaacagaatatgcaccgaaatttgtaatacgtatggggcttacc
accttcggagaatctggccctgcaaaagaactggcggatttttacggattctcaccggag
aatattgcaaaaacggtaaaagaaaatttataa

DBGET integrated database retrieval system