KEGG   Blautia sp. YL58: A4V09_17340Help
Entry
A4V09_17340       CDS       T04458                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
byl  Blautia sp. YL58
Pathway
byl00473  D-Alanine metabolism
byl00550  Peptidoglycan biosynthesis
byl01100  Metabolic pathways
byl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:byl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4V09_17340
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4V09_17340
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A4V09_17340
Enzymes [BR:byl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4V09_17340
Peptidoglycan biosynthesis and degradation proteins [BR:byl01011]
 Precursor biosynthesis
  Amino acid ligase
   A4V09_17340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST GARS_A RimK ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: ANU77352
UniProt: A0A1C7IGR4
LinkDB All DBs
Position
complement(3722488..3723519)
Genome map
AA seq 343 aa AA seqDB search
MNIVVLAGGSSTEREVSIVSGQGICTALRKRNHKAVLVDAYFGKEEWGKEMFPLTYDIDA
ETAYMQAKSRELEETMKSRKEFFGPNVLDICKAADMVFLALHGSNGEDGKVQSVFDLMGI
PYTGSGPLSSGMAMDKGITKMVFEAKGVPTPKGVTLQKGKCSSELADYDMDFPVIVKPCC
GGSSVGVCIAKNQEEYEAALEESFSYENEAVVEQFIEGREFSVAVVDGKAYPVIEIAPLQ
GFYDYKNKYEAGSTIETCPAELPETLTREMQKYAELGYKALALQAYARLDFILDKEGNMY
CLEANTLPGMTPTSLIPQEAKVLGMDYPELCEKLIEVSLKKYK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttgttttagcaggcggcagcagtacggagagggaagtttccattgtgtcc
ggacagggtatctgcacagctttgcgcaaaagaaatcataaggcagtattggtggacgcg
tattttggaaaagaggagtggggtaaggagatgtttccccttacctatgatatagatgcg
gagactgcttatatgcaggcaaaaagcagggaactggaagagaccatgaagagcaggaaa
gaattcttcgggccgaatgtactggacatctgcaaggccgcagatatggttttcctggcc
ctgcacggctccaatggggaggacggcaaggttcagtcagtatttgacctgatgggcatt
ccatacaccggttccgggccgctgagcagcgggatggctatggataaaggcatcacaaaa
atggtatttgaagcaaaaggagtacccacacccaagggtgtgaccctgcagaagggaaaa
tgcagcagtgaactggctgactatgatatggatttcccggttatcgtcaaaccatgctgc
ggcggttccagtgtgggcgtgtgtattgctaagaaccaggaagagtatgaggcagccctt
gaggaatctttttcttatgaaaacgaagcagttgtggaacagttcattgaggggcgtgag
ttctctgtagctgtagtggacggcaaggcatatccggttattgagattgcgccgcttcag
ggattctacgattataagaacaaatacgaggcaggttctaccatagagacgtgtcccgct
gaactgcccgaaacactgaccagggagatgcagaaatacgctgaactgggatataaggca
ctggccctgcaggcatatgcaagactggacttcattttggacaaagaaggaaatatgtac
tgtctggaggccaatacgctgccggggatgacacctaccagccttatcccccaggaggca
aaggtattgggcatggattacccggaactgtgcgagaaactgatcgaggtttccctgaaa
aaatataaatag

DBGET integrated database retrieval system