KEGG   Blautia sp. YL58: A4V09_21110Help
Entry
A4V09_21110       CDS       T04458                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
byl  Blautia sp. YL58
Pathway
byl00340  Histidine metabolism
byl01100  Metabolic pathways
byl01110  Biosynthesis of secondary metabolites
byl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:byl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A4V09_21110
Enzymes [BR:byl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     A4V09_21110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG MazG-like
Motif
Other DBs
NCBI-ProteinID: ANU78784
UniProt: A0A1C7IIP2
LinkDB All DBs
Position
4562705..4563028
Genome map
AA seq 107 aa AA seqDB search
MDVIKGLYDVALERKAVKQEGSYTCYLFEQGLDKILKKCGEECSEVIIAAKNGENGDTAN
EICDLLYHLVVMMVQSGISIDEVEGILEERRQKIGNLKKFHESDHES
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgatcaagggattgtatgatgtggctttggaacgcaaggctgtaaaacaggaa
ggttcttatacctgctatctttttgagcaggggcttgataaaattttaaaaaagtgcggt
gaggagtgcagtgaggtgatcattgctgcaaaaaatggggagaatggggatacggctaat
gaaatctgtgaccttctttatcatttggtggttatgatggtgcagagcgggatttctatt
gatgaagtggaagggattctggaggagagacggcagaagattgggaatcttaagaagttt
catgaaagtgatcatgagtcctga

DBGET integrated database retrieval system