KEGG   Bipolaris zeicola: COCCADRAFT_21455Help
Entry
COCCADRAFT_21455  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bze01001]
    COCCADRAFT_21455
Enzymes [BR:bze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     COCCADRAFT_21455
Protein kinases [BR:bze01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   COCCADRAFT_21455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 19144994
NCBI-ProteinID: XP_007706320
JGI: 21455
UniProt: W6YJ48
LinkDB All DBs
Position
Unknown
AA seq 398 aa AA seqDB search
MATKTSNGGSGAQAPQTPQVQPCRYKTGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRL
MAGREHMVRNEIAVLKRVSMGHRNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGNY
YESDAGDLIRATLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQ
FHVLTTTCGTPGYMAPEIFRKTGHGKPVDIWAIGVITYFLLCGYTPFDRDSNLEEMQAIL
VADYSFTPLEYWRGVSLTAREFIRRCLTVDPAARMTAHEALSHPWITELGKNNADGEEDL
LPTVKKNFNARRTLHAAIDTIRAINQLRAGGAAGMMDGQRSAEPRRGAPHARIPQPADEP
DDPMEIDSRGNGHGQTEEMIQEQERRIRETQQGLWGKR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaagacttccaacggtgggtctggggcacaggcaccacaaacaccccaggtc
cagccttgcagatacaagacgggcaagactctgggtgcgggcagctactcagtcgtcaag
gagtgtgtgcacatcgatacagggcgatactatgccgcaaaggtcatcaacaagaggctt
atggccggccgagaacacatggtcaggaacgagatcgcagtattgaagagagtttccatg
ggccacaggaatatccttacactcgtcgactactttgagacgatgaacaacctctatctg
gtcaccgaccttgcgcttggaggcgagctcttcgaccgcatctgtcgtaagggaaactac
tacgaatccgacgccggcgacctgatcagggctactctctcggcagtcgcatatctccac
gaccacggtatcgtgcaccgagatttgaagccggagaacttgctgttccgaacaccagag
gacaatgccgatttgcttatcgccgatttcggactttctcgtatcatggacgaggagcaa
ttccacgtcctcacaacaacctgcggtacgccaggctacatggcgcctgagattttcagg
aagacgggtcatggcaagccagtcgacatttgggccattggtgttattacgtattttctg
ctttgtggctatactcccttcgaccgcgactcgaaccttgaagagatgcaagccatattg
gttgccgattattcttttacccctctagaatactggcgaggcgtctcactcacggcgcgc
gagttcattcgtcgatgcttgactgtggatcctgcagcacgcatgaccgctcatgaggct
ctctcccatccctggatcacggagcttggcaagaacaatgctgacggcgaagaggatctg
ttgccaactgtcaagaagaactttaatgctaggcgcacacttcacgctgctattgacacg
atccgtgctatcaatcaactccgagctggtggtgctgcgggtatgatggacggtcagcga
tcagcggaaccccgacgaggggcgccccacgcgcgtattccccaaccggcagatgaaccc
gacgacccgatggagatagacagcaggggaaatggccatggccagaccgaagagatgatc
caggaacaagagcggagaattagggagactcagcagggattatggggaaagcgctga

DBGET integrated database retrieval system