KEGG   Bipolaris zeicola: COCCADRAFT_22268Help
Entry
COCCADRAFT_22268  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bze  Bipolaris zeicola
Pathway
bze04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bze00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    COCCADRAFT_22268
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCCADRAFT_22268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 19145157
NCBI-ProteinID: XP_007707311
JGI: 22268
UniProt: W6YG19
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNIKGTVTFEQADESSPTTISWDITGHDANAERGMHIHAFGDNTNGCTS
AGPHFNPHNKTHGAPSDEERHVGDLGNFKTDGQGNAKGTVTDKLIKLIGSESVIGRTIVV
HAGTDDLGKGGHEESKKTGNAGGRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagccgtcgccgtcctccgtggagactccaacatcaagggaaccgtcactttt
gagcaggccgacgagtcctcccccaccaccatctcatgggacattaccggccacgatgcc
aacgctgagcgtggcatgcacattcacgccttcggtgacaacacaaacggctgcacatct
gctggaccccacttcaacccccacaacaagacccacggtgcccccagcgacgaggagcgc
cacgtcggtgacttgggcaacttcaagaccgacggccagggcaatgccaagggcaccgtc
accgacaagctgatcaagctcatcggctccgagagcgtcattggccgcaccattgtcgtt
cacgctggcactgacgaccttggcaagggtggccacgaggagtccaagaagactggtaac
gctggaggccgtcctgcttgcggtgtcattggtatctccaactaa

DBGET integrated database retrieval system