KEGG   Bipolaris zeicola: COCCADRAFT_26059Help
Entry
COCCADRAFT_26059  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bze03036]
    COCCADRAFT_26059
Chromosome and associated proteins [BR:bze03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    COCCADRAFT_26059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 Ge1_WD40 Coatomer_WDAD Frtz TFIIIC_delta DNA_pol_alpha_N
Motif
Other DBs
NCBI-GeneID: 19145931
NCBI-ProteinID: XP_007712008
JGI: 26059
UniProt: W6Y1V3
LinkDB All DBs
Position
Unknown
AA seq 890 aa AA seqDB search
MSSVQRLRARQAHAPGATYLAYTPNGKKLVTTGVDNYCRVFTTGSDDEPVTIDECQENNT
AVVAGNGFFITGSEDGTVSRFSLDSGKFEEILFRTTLPVRDVAISSDGNWIAVASDELVV
NVVSVKNKSMRTLRDQSRAVKHVSFDKTGTQLAVSCTDGQVYMYNLDGDEPEMVKRIEGM
IKSLETESESSSRVLWHPDGRAFATPTAMRQMQVMSTNDWERQRVFKTGHSADITAAAWS
PNGALLATTSSDLSLCLWDTKTQQLLHKFDHLKATILAMAWHPTENILSYTNNEGELFIH
TDIVPEEHLPLLQKPTVSAPFFHDPSEGRAGVPQPAKLTAGNVHTLPGRPRPRSGTPDSL
EDILGPEFQDDEAQEDGDEEMNDFVIDDDGAGYAPAAIHAAKKRSNGHLANGVEPASKRR
AYSSALFRPQVHEPFQPGSTPWRGNRRLLCCSLTGYVETVEQEGNHHTVTVKFYDEHTFR
NFHFTDIFLYDKACLNEKGTLFACQPNSTGEGNQAMIYYRPHEMWTTRTEWRTNLPTGES
VTAIALSDSYVCVTTSTNYVRIYSLFGLPIRVYRQKSSPAVTCAAWRDYILTIGNGPIQN
DLSTQLLYTIENIKHDIVYQDSDILALPPGTTLTSVFFSAEGDPYIYDSDGVLLTLLGWR
NTGQARWVPMLDTKLLSRRAGGGKEESYWPVGVASSPSADSSTNGKFHCMIIKGREQYPS
APIPHLSEFGFEIPLSSAIDKSKKAKGRKGGAMSDDEEDDEEDETTKPQTNEDKQQEHEQ
AFILSSTLHSQLSSTLLHTRPTSSQKAALSALEVAIDRALLQLLGLECLAGEDHGMKALE
IVSLMRDANGKMLDLAGKVASRYGREVLGDKIRELAEKKALARDDDEDDL
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtccagcgattgcgtgctcgccaggctcatgcccctggtgcaacttacctt
gcctacactcccaacggcaagaaactcgtcactactggagtcgacaactactgccgtgta
ttcaccacgggatctgacgatgagcctgttactatagacgaatgccaggagaacaatacg
gccgtagtcgctggcaatggcttctttatcaccggttccgaggatggcacagtgagcaga
ttctccctcgacagcgggaaatttgaagagatactcttccggaccaccctgcccgtacga
gacgtagcaattagttcggacggcaactggattgctgttgcaagcgatgagcttgttgtg
aatgtcgtaagcgtaaagaacaagtctatgcgaaccctacgcgatcagtctcgagccgtg
aaacatgtctctttcgacaagaccggaacccaactcgctgtatcctgcaccgacggtcaa
gtctacatgtataacttggatggagatgagcctgagatggtcaagaggatagaaggcatg
atcaagagcttggaaacagagtcagagtccagttcaagggtgctgtggcatcctgatgga
cgagcatttgctacacctactgccatgcgccagatgcaagtcatgtcgacaaatgactgg
gagagacagcgggtgttcaagacaggccactctgcagatatcacagctgcagcatggtca
cccaatggcgctctgttagcaaccacatcgagtgatctcagtctctgcctatgggatacc
aagactcaacagctactccacaagtttgaccatctcaaggcgaccattctggcaatggca
tggcaccctacggaaaacatactctcctacaccaacaacgaaggcgagctcttcatccac
acagacatcgtccctgaggagcacctccccttactccagaagcctaccgtctcggcaccc
tttttccacgatccatcagaaggccgagccggtgtccctcagccagctaagcttaccgca
ggaaatgttcacactctcccaggacgacctcgaccaagaagcgggacaccagactccctg
gaggacatcctaggccccgagttccaggatgacgaagcacaagaagatggcgatgaggaa
atgaacgactttgtcattgatgatgatggcgcaggctatgcacctgccgccatccatgcg
gcaaagaagcgttcgaatgggcatctcgcaaatggcgtagaacccgcatcaaaacgacgc
gcatatagctccgctcttttccgtccccaagtccatgagcccttccaaccgggtagcaca
ccatggcgcggtaaccgccggttactatgctgttcgttgaccggatacgtagagacggtc
gagcaagaaggcaatcaccatacagtcaccgtgaaattctacgacgagcatacctttcgc
aatttccacttcactgacatcttcctctacgacaaagcctgtctcaacgagaaagggacc
ctattcgcctgccaaccgaatagcactggagagggaaatcaagctatgatctactaccga
ccgcacgagatgtggacaacaagaacggagtggcggaccaacctgccaacaggagagtct
gtgacagcaattgccttgtctgactcttacgtatgcgtcacaacttctacaaactacgtg
cgcatatactctcttttcggcctacccatccgcgtataccgtcaaaagagctctcccgca
gtgacatgtgcagcctggcgcgactacattctcaccattggcaacggacccatccaaaac
gacctcagcacacagctcctctacacgattgaaaacatcaagcacgacatcgtgtaccaa
gattctgatatccttgccctacctccaggcaccacactgacttctgtcttcttctcggca
gaaggcgacccatacatttacgattccgacggcgtcctcttaacactgcttggctggaga
aatacaggacaagcccgctgggtccccatgctcgacacgaagctcctctcgcgtcgcgcc
ggcggcggaaaagaagaatcatactggcccgttggcgttgcgtcctcaccgtcggcagac
agtagcaccaacggcaagttccactgcatgattatcaagggcagagaacaatatcccagc
gcaccgatcccgcacctgtccgagtttggctttgagattccgctgtcgagtgcaattgat
aagagcaagaaggccaagggtcgaaagggtggtgcgatgtctgatgacgaggaagatgac
gaagaagatgaaacgacgaagccgcagacgaatgaagataagcagcaggagcatgaacag
gcgtttattctttcgtcgacattgcactcgcagctttcgtcgacactgttgcatactcgg
cccacgtcttcgcaaaaggcggcgctgagtgcgctcgaggtagcgattgatcgtgccttg
ctccagttactcggcttggagtgtctggcaggtgaggaccatggtatgaaggctctggaa
atagtaagcctgatgcgcgatgccaatggcaaaatgttggatctggcaggcaaggttgct
tcacgctacggtcgcgaggtactgggcgacaagattcgggagttggctgagaaaaaggca
ctggctagggacgatgacgaagatgatctatag

DBGET integrated database retrieval system