KEGG   Bipolaris zeicola: COCCADRAFT_28447Help
Entry
COCCADRAFT_28447  CDS       T03110                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bze  Bipolaris zeicola
Pathway
bze00052  Galactose metabolism
bze00500  Starch and sucrose metabolism
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCCADRAFT_28447
   00500 Starch and sucrose metabolism
    COCCADRAFT_28447
Enzymes [BR:bze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     COCCADRAFT_28447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19146405
NCBI-ProteinID: XP_007714980
JGI: 28447
UniProt: W6YHE3
LinkDB All DBs
Position
Unknown
AA seq 1009 aa AA seqDB search
MTHTSFVQASTVLSSLLALTAGQAPTTSSNGGWSTTLAGTPTSFNPVFTIPPSADKGVQQ
IPNIYDAQAVDAQDVCPGYTASDLQQSDRGLTATLTLAGKPCNVYGTDIQELDLKVEYQA
KGRLSVNIVPKHIGASNQSHWIVPEDLIPRPQVEESSEQADLKFNWGNEPSFWFNIERRS
TGDVIFTTQDTKLIYENQFVEFVNNLPEDYNLYGLGERIHGLRLNNNFTATIYAADVGDP
IDRNLYGSHPFYLETRYFEKGESRSTKPLTQSEIAQKKDAKTNGSPYESRSHGVYYRNTH
GMDVVMKPDHLTWRTLGGAIDLYFFDGPSQPDVTKAYQKAAIGLPAMQQYWTFGFHQCRW
GYRNWTETREIVETMRAFNIPMETIWLDIDYMDQYRDFTLDPVTFPPSDVAEFFGWLHGN
NQHFVPIVDAAIYIPNPQNASDAYDTYTRGNESGVFLSNPDGSQYIGAVWPGYTVFPDWL
SPNGVSWWVKEMVEWYKEVPYSGFWVDMTEVSSFCVGSCGTGNVTLNPAHPPFSLPGEVN
NVIYDYPESFNITNGTEAASASAAASAQESRKASATATVTDEVTSTSTSYFRSTPTAGER
NINYPPYVINHVQDGADLAVHAVSPNATHANGVEEYDVHNLFGHQIINATYQGLLSVFPG
KRPFIIGRSTFAGSGKWAGHWGGDNASKWAYMFFSIPQALSFSLFGIPMFGVDTCGFNGN
TDMELCSRWMQLSAFFPFYRNHNVLSAIPQEPYRWEAVASASRTAMHIRYSLLPYMYTLF
NDAHKTGSTVMRALAWEFPNEPQLAGVDTQFLLGPNILVTPVLEPQVDTVKGVFPGIVDG
ETWFDWYSGERVQAEAGVNTTISAPLGHIPVYIRGGSVLPIQEPGYTTTESRQNPWGLIV
ALSGEGAASGHLYVDDGESIEPESCLDVTFAATSGKLEVDVQGEFKDTNALANVTVLGAP
EVQHVKLNGEVVDASNVDYNKTSSVLKLTGLNELTSAGAWHGSWTLTWE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacacgagtttcgtccaggcttctactgtgctgtcctctcttctcgcactcaca
gctggccaagcacccaccacttcttcgaatggtggatggagcactacgctcgctggcacg
cccacctccttcaaccccgtctttaccattcctccatctgccgacaagggcgttcaacag
atccccaacatctacgatgctcaagctgtcgatgcgcaagatgtttgtcctggttacaca
gcatcagaccttcagcagagtgatcgcggcctgaccgccacattgaccttggctggaaag
ccatgcaatgtttacggcaccgatatccaggaactagacttgaaggtcgagtaccaggcc
aagggaaggctgtcagtcaacattgtaccaaagcacattggtgcaagcaaccaatcgcac
tggattgttcccgaagatctcattccgcgtcctcaggtcgaggaatcatccgagcaggct
gatctcaagtttaattgggggaatgagccatctttttggttcaatattgagcgtcgctcg
accggagacgtcatattcacaacccaagacaccaaactcatttacgagaatcagtttgtt
gagtttgtaaacaacctgccagaggactacaacctctacggcctgggcgaacgaattcac
ggtcttcgtctcaacaataacttcactgcgaccatctatgctgctgacgtaggtgatcct
atcgaccgcaacctgtacggcagccatcctttttacctcgagacccggtactttgagaag
ggtgagagccgtagcaccaagcccttgacgcagtccgagatcgctcagaagaaagatgcc
aaaaccaatggttcgccctacgagtcgcgttctcacggcgtttattaccggaacacccat
ggtatggacgtagtgatgaagcccgatcacctaacttggaggaccttgggaggtgctatt
gatctgtacttcttcgatgggccttcgcagccggacgttactaaagcgtatcaaaaggcg
gctattggcctgccagcaatgcagcaatactggacctttggctttcatcaatgccgttgg
ggttaccgcaactggaccgagactcgagaaattgttgagactatgagagctttcaacatc
ccaatggaaaccatctggctcgacattgactacatggaccagtaccgtgactttacgctg
gatcccgtgactttccctccctctgacgtggctgaattctttggatggctgcatggaaac
aaccagcatttcgtacccatcgttgatgcagctatctacattcccaacccacaaaacgca
agcgatgcatatgacacatatacgcgtggcaacgaatctggcgtattcttgtccaaccca
gacggcagccaatatatcggtgctgtttggcctgggtatactgttttccctgattggttg
tcgcccaacggtgtatcgtggtgggtaaaggagatggttgagtggtacaaagaggtgcca
tacagcggtttctgggttgacatgaccgaagtctcttctttctgcgtcggatcttgcggt
actggcaacgtcaccctgaacccggctcatccgcccttctcgcttcccggtgaggtcaac
aacgtcatctacgattacccggagagcttcaacatcacaaatggtaccgaggcggcgtcc
gcttctgcagcagcttccgcccaagagtccagaaaggcaagtgcgacggcgacagtgacc
gacgaagtgacttctacttcgacaagctacttccgctcgacccctaccgctggggagcga
aacatcaactatcctccttatgtcatcaaccacgtacaagacggcgctgatcttgctgtt
catgctgtcagccccaatgcaacccacgcgaatggcgtagaagaatacgatgtccacaac
ctcttcggtcaccagattatcaatgctacttaccaaggtctcctttcggtgttccctgga
aagcgtccctttatcattggacgttccacatttgctggcagcggcaagtgggctggtcat
tggggcggcgataacgcgtctaaatgggcctacatgttcttctcgattccacaagcattg
tccttttcactattcggtattccgatgtttggtgtcgacacctgtggattcaacggaaac
accgacatggagctttgctctcgatggatgcagctttcggcctttttccccttctaccgc
aaccacaacgtactctcagccatcccccaagagccctaccgatgggaggctgtggcttct
gcttcaaggaccgcaatgcacatccgttactctctgttgccgtacatgtacacgctattc
aatgacgcccacaagactgggtcaactgtgatgcgggcgctggcttgggaattccccaac
gagccccaactcgctggtgtggatacacagttcttgcttggaccaaacatcctagtcaca
cctgtactcgagcctcaagtcgatactgttaagggagtatttcctggtatcgttgacggc
gagacctggtttgactggtattctggcgagcgtgtccaggctgaggctggcgtaaacacg
accatctctgcacctttgggccatatccctgtatatattcgcggaggttcggtcctgcct
attcaggagcctggatacacgacaaccgagtcccgccagaacccctggggtctcattgtc
gcactctctggcgaaggcgccgcatctggtcacctatacgttgacgacggtgaatctatc
gagccagagtcgtgcctcgatgttacgtttgctgctacgagcggaaagttggaggttgat
gttcaaggcgaattcaaggacaccaacgcgcttgccaacgtgacagtgttgggagcccct
gaggtccaacacgtcaagctgaatggtgaggtggtcgatgctagcaacgttgattacaac
aagaccagtagcgttttgaagctgacgggcctcaatgagttgacaagtgctggagcttgg
catggtagctggacgttgacttgggaataa

DBGET integrated database retrieval system