KEGG   Bipolaris zeicola: COCCADRAFT_2957Help
Entry
COCCADRAFT_2957   CDS       T03110                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bze  Bipolaris zeicola
Pathway
bze00500  Starch and sucrose metabolism
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCCADRAFT_2957
Enzymes [BR:bze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     COCCADRAFT_2957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19146594
NCBI-ProteinID: XP_007709756
JGI: 2957
UniProt: W6YWQ7
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MLPRVLLLTGFVHHAYTLSIPRLPSLATFAASSRVQQQQPLQDTLDAWIKHEEHIALDKL
LANVAPGGSNVQGKGVAEGTVIASPSQDGPDYWFQWVRDAAITMDTLVNIYADDTSSSRA
ASLSTILDAYTSLQGDIQRTSNPSGTFDDLSGLGEPKFQVDGKPFTGSWGRPQRDGPALR
ALTLMHYLREYNASHPSLWSSPDSEDFFGSFYTAEMPPRSIIKADLEYVSHFWNQSGFDL
WEEVEGLHFFTLMVSARSLKEGSHLARTFGDFGAADWYQKQAGYIENLLGKFWNAQKGHL
VETLWSKRSGLDCGLLLGSLHALPKSGSEDDVVYPPWSDEILVSLLALTRDQRDRFPINS
NPSDQDDDDDNVDEFTFEGTGLGRYPEDVYDGYGNSNRGGNPWFLCTSSAAEILYRTASH
ISATGNLTITDVGLPFYESLLGSSSLDVDVGTFGPTDALFHSIIERIQSTGDEFLQVVKT
HVDAEGSMSEQFDRVTGYMRGAQHLTWSYGAFLQAARARKISVH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctcgcgtgctcctcctcacaggctttgtccaccatgcctacacattatcgata
cctcgtcttccctccctagccacttttgctgcttccagccgtgtgcagcaacagcaaccg
cttcaagacacacttgatgcctggataaagcatgaagagcacattgcactggacaaactg
ctcgccaacgttgcgcctggaggtagcaatgttcaagggaaaggtgtggccgagggcacc
gtcatcgccagtcccagtcaagacggtccggactactggttccaatgggtccgtgacgct
gctatcaccatggataccctcgtcaacatctatgccgacgacacttcgtcctcgcgcgcg
gcttctctatccaccatcctagacgcatacacctccctccaaggtgacattcagcgcacc
tcaaacccgtctggcacattcgacgacctttccggactaggtgagcccaagttccaagtc
gatggcaagccgttcaccggctcgtggggacgacctcagcgcgatgggccggcccttcgc
gcactgacgctcatgcattacctccgcgagtacaacgcatcgcatccctcactatggagc
tcccccgactccgaagactttttcggctcattctacaccgctgaaatgcctcctcgtagc
attatcaaagcagatctcgagtatgtcagccatttctggaaccagtcgggattcgatctc
tgggaggaggttgagggcctgcacttcttcaccctcatggtcagcgcgaggagtctgaag
gaaggcagtcaccttgccagaacctttggagactttggtgcggctgactggtaccaaaag
caagctggctacattgagaatctgttgggcaaattctggaatgcgcaaaaaggacatctt
gttgagacgctatggagcaagaggagtggcctcgactgcggactgcttctcggctctttg
cacgcccttcccaagagcggatcggaagatgatgtcgtgtatcctccgtggtccgatgag
attcttgtttctctgcttgctttgactcgggatcagcgcgaccggttccccatcaacagc
aatccttctgaccaggatgacgatgatgacaatgtagatgagttcacattcgagggaacg
ggccttggccgctatcccgaagatgtatacgacggctatggaaactcgaaccgtggtgga
aacccatggttcctgtgcacctcttcagccgcagagattctgtaccgcaccgcctcgcac
atttctgccaccggcaacttgactattactgatgttggtcttcccttttacgagtctctc
ctcggtagctcctctctagatgtcgacgtaggcacgtttggccccacagacgccctcttc
cactccatcatcgagcgcattcagagcaccggcgacgagtttctgcaagtcgttaagacg
catgtggatgccgagggcagcatgagtgagcagtttgatcgtgtgactggatacatgcgt
ggtgctcagcatttgacttggagttatggtgcctttttacaggctgctagagcaagaaag
atttctgtgcattag

DBGET integrated database retrieval system