KEGG   Bipolaris zeicola: COCCADRAFT_35005Help
Entry
COCCADRAFT_35005  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
bze  Bipolaris zeicola
Brite
KEGG Orthology (KO) [BR:bze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bze03012]
    COCCADRAFT_35005
   03029 Mitochondrial biogenesis [BR:bze03029]
    COCCADRAFT_35005
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bze04147]
    COCCADRAFT_35005
Translation factors [BR:bze03012]
 Eukaryotic Type
  Elongation factors
   COCCADRAFT_35005
 Prokaryotic Type
   COCCADRAFT_35005
Mitochondrial biogenesis [BR:bze03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    COCCADRAFT_35005
Exosome [BR:bze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   COCCADRAFT_35005
  Exosomal proteins of breast cancer cells
   COCCADRAFT_35005
  Exosomal proteins of colorectal cancer cells
   COCCADRAFT_35005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 19147889
NCBI-ProteinID: XP_007710192
JGI: 35005
UniProt: W6YVK1
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MSSFSKVFLRTSRAAVQYQRGVSPVQNALGAQGTSRWMNGVRNYAAFTRDKPHVNIGTIG
HVDHGKTTLTAAITKRQAEKGFAKYLDYGSIDKAPEERKRGITISTAHIEYQTENRHYAH
VDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKVD
AVEDKEMLELVEMEMRELLSSYGFEGDETPIVMGSALCAIENRQPEIGVTKIDELLEAVD
SWIPTPQRETDKPFLMAVEDVFSIAGRGTVVSGRVERGILKRDAEVELVGKGTAPIKTKV
TDIETFKKSCEESRAGDNSGLLLRGVKRDEVRRGMVVSVPGQVKAHKKFLVSMYVLSKEE
GGRHTGFGENYRPQMFIRTADESCALFWPEGTEDAHEKLVMPGDNVEMVCELHAPHVLET
GQRFNMREGGRTVATGLVTRVLE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcttttcaaaggttttcctgcgcacttcgcgtgctgccgtgcagtaccagcgt
ggcgtctcgccggtgcagaatgccttgggtgcgcagggcaccagcaggtggatgaacggc
gtccgcaactacgccgcctttacacgagacaagcctcatgttaacattggtacgattggc
cacgtcgatcacggaaagaccactctcacagccgccatcaccaagcgacaagcagaaaag
ggctttgctaaatacctcgactatggctccattgacaaggcccccgaagagcgcaagcgt
ggtatcacaatctcgaccgcccacattgagtaccaaaccgaaaaccgccactacgcccac
gtcgactgccccggtcacgctgattacatcaagaacatgattacgggagccgccaacatg
gacggtgccattattgttgttgccgcttccgacggtcagatgccccagacccgtgagcac
ttgctgctcgcccgccaggtcggtgtccagaagatcgttgtcttcgtcaacaaggtcgac
gctgttgaggacaaggaaatgttggagcttgtcgagatggaaatgcgcgaactgcttagc
agctatggctttgagggtgacgagacccccattgtcatgggctctgccctctgtgccatt
gagaaccgccagccggaaattggtgtcaccaagattgacgagctgctcgaggccgtcgat
tcatggattcctactcctcagcgtgagactgacaagcctttccttatggccgtcgaggac
gtcttctccattgctggtcgtggtaccgtcgtttctggccgtgttgagcgaggtattctg
aagcgcgatgctgaagtcgagcttgtcggcaagggtaccgcgcccatcaagaccaaggtt
accgacattgagaccttcaagaagtcttgtgaagagtctcgcgctggtgacaactctggt
cttcttctacgtggtgtcaagcgtgacgaagttcgtcgtggtatggtcgtttccgtcccc
ggacaggtcaaggctcacaagaagttcctcgtctccatgtacgtcttgagcaaggaggag
ggtggtcgccacactggtttcggcgagaactacaggccacaaatgttcatccgcactgct
gatgagtcgtgtgcgctgttctggcccgaaggtaccgaggatgcccatgagaagcttgtc
atgcctggtgacaacgtcgagatggtttgcgagctccatgcaccacacgtcttggagact
ggccagcgcttcaacatgcgtgagggtggccggacagtcgctactggtttggtgacgcgt
gttctggagtag

DBGET integrated database retrieval system