KEGG   Bipolaris zeicola: COCCADRAFT_8379Help
Entry
COCCADRAFT_8379   CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bze  Bipolaris zeicola
Brite
Enzymes [BR:bze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     COCCADRAFT_8379
Peptidases [BR:bze01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   COCCADRAFT_8379
Exosome [BR:bze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCCADRAFT_8379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 19151639
NCBI-ProteinID: XP_007716292
JGI: 8379
UniProt: W6YDY1
LinkDB All DBs
Position
Unknown
AA seq 261 aa AA seqDB search
MRFQSMITAALPALVLSAPTPQWDDVPEDSIVGGTTAAAGEYPFIVSIQLGGRHNCGGTL
INGNTVVTAAHCSVSSAIGGSINNVAVRVGSLSANSGGQVIKVSKIIIHPSYQASTSNND
IAIWKLSSTVTAGGNIGFASLAASGSDPASGSTTSVAGWGATREGGGANNALLKVSVPIV
ARSTCVSNYNAVGLTVTTNMVCAGVTAGGRDSCQGDSGGPLVDANKTLIGVVSWGTGCAR
PNLPGVYSRVGTLRSFIDQNA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccagtctatgatcactgctgcgcttcctgcgctcgtcctctccgctcctact
ccccagtgggatgatgttcctgaggactccattgttggtggaaccaccgctgctgccggc
gagtaccccttcatcgtctctatccagcttggcggtcgccacaactgcggtggtaccctc
atcaacggcaacaccgttgtcactgctgcccactgctccgtcagcagcgccattggcggc
tccatcaacaacgtcgctgtccgcgtcggctccttgagcgccaactctggtggccaagtc
atcaaggtctccaaaatcatcatccaccccagctaccaggcaagcacctccaacaacgac
attgccatctggaagctttccagcaccgtcactgccggtggcaacatcggctttgcttcc
ctcgccgcctctggctctgatcccgccagcggatccaccacctccgttgctggatgggga
gctacccgtgagggtggcggcgccaacaacgctctcctcaaggtcagcgtccccattgtt
gcccgctccacctgcgtgtccaactacaacgccgtcggtctcaccgtcaccaccaacatg
gtctgcgctggtgtcactgctggtggccgcgactcttgccagggcgactctggcggccct
ctcgtcgacgccaacaagaccctcatcggcgtcgtctcctggggaaccggctgcgctcgc
cccaacctccccggtgtctactcccgcgtcggcaccctccgcagcttcatcgaccagaac
gcttaa

DBGET integrated database retrieval system