KEGG   Bipolaris zeicola: COCCADRAFT_85691Help
Entry
COCCADRAFT_85691  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bze  Bipolaris zeicola
Pathway
bze00020  Citrate cycle (TCA cycle)
bze00190  Oxidative phosphorylation
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01200  Carbon metabolism
Module
bze_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCCADRAFT_85691
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    COCCADRAFT_85691
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     COCCADRAFT_85691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19152001
NCBI-ProteinID: XP_007708277
JGI: 85691
UniProt: W6YPE3
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSCLRMRRTQLASQLARSFRPSTRAFSSTRPFQRIIATENLRAKEASGFISSKYPVIDHQ
YDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFGGQSQKYG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEFFATDLIMEDGVCKGVVAYNQED
GTIHRFIAKNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDMEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTQDAQGNDQVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFSPGQT
ADPVSADAGADSIAVLDKVRTSEGTKSTAEVRLQMQKVMQTDVAVFRTQESLDEGVKKIR
EVDADFVNVGIKDRSMIWNSDLVETLELRNLLTCAVQTAESAANRKESRGAHAREDYPDR
DDEQWMKHTLSWQKQPHGETKLGYRAVTGTTLDEAECKAVPPFKRTY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtctcaggatgcgtcgcacgcagcttgcgagccagctcgcgaggagtttccgc
ccaagcacacgtgctttctcctcaactcgacccttccaacgtataatcgctaccgagaac
ctgcgagcaaaggaggcttcaggcttcatctccagcaagtaccctgtcattgaccatcaa
tacgatgccattgtggttggcgctggaggagctggtctgcgagcagctttcggtctcgcc
gaggcgggcttcaacacggcctgtatctcaaagcttttccccactcgatcgcacacggta
gctgcgcagggtggtatcaatgcggcgcttggaaacatgcacgaggatgattggaggtgg
cacatgtacgataccgtcaaaggttcagattggcttggtgaccaggacgctatccactac
atgacaagagaggccccacagtctgtcatcgagctcgagaactacggttgcccattctcc
agaaccgacgacggcaagatttaccaacgtgcctttggtggtcaatcgcaaaagtatgga
aagggcggacaggcataccgatgctgtgctgccgccgacagaactggtcacgctctcctg
cacacgctctacggacaatctctccgccacaacaccaaatacttcattgagttcttcgct
accgatttgatcatggaagatggcgtctgcaagggtgtcgttgcctacaaccaggaagac
ggaactatccaccgtttcatcgctaagaacactgttttggccactggtggttacggacgt
gcctacttcagctgcacatcggctcacacctgtaccggtgacggtatggccatggttgct
cgcgcaggtctccccaatcaggacatggagttcgtccagttccaccccactggtatctac
ggcgctggatgcttgatcactgagggttcccgtggagagggtggttatcttctcaactcc
gagggtgagcgattcatggagcgttatgcacccaccgccaaggatcttgcctcgcgtgac
gttgtctctcgatcgatgactctggaaatccgtgaaggccgtggtgttggtcctgagaag
gaccacatctaccttcagctcagccacctgcctcctgaggtcctccacgagcgtctgccc
ggtatctctgagaccgctgccatttttgctggtgtagatgttaccaagcagcccattccc
gtccttcccactgttcactacaacatgggtggtatccccaccaagtacactggtgaggtt
ctcactcaagacgcccagggtaacgaccaagttgtgcctggtctattcgcttgcggtgaa
gctgcgtgcgtgtctgttcacggagctaaccgtctcggtgccaactcattgctcgatctt
gttgtctttggacgtgctgtttcccacaccatccgcgacaacttcagccccggccagacc
gctgatcccgtatctgccgatgccggtgccgactccatcgccgtcctggacaaggtccgt
acctccgagggcaccaagtccaccgccgaggtccgcctacagatgcaaaaggtcatgcag
actgatgtcgccgtcttccgaacacaagagtcgctcgatgagggtgtcaagaagatccgc
gaggttgatgccgactttgtcaacgttggtatcaaggaccgcagcatgatctggaactcg
gaccttgtcgagactcttgagctacgaaacttgctcacttgcgctgttcagactgccgag
tctgccgccaaccgcaaggagtcgagaggcgcccacgcccgcgaggactaccccgaccgt
gacgacgagcagtggatgaagcacacactgtcgtggcagaagcagccacacggtgagacc
aagcttggctacagggcagtgactggtaccacgctagacgaggccgagtgcaaggctgtg
ccaccattcaagcgtacctactag

DBGET integrated database retrieval system