KEGG   Bipolaris zeicola: COCCADRAFT_86083Help
Entry
COCCADRAFT_86083  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bze  Bipolaris zeicola
Pathway
bze00010  Glycolysis / Gluconeogenesis
bze00051  Fructose and mannose metabolism
bze00052  Galactose metabolism
bze00500  Starch and sucrose metabolism
bze00520  Amino sugar and nucleotide sugar metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01200  Carbon metabolism
Module
bze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCCADRAFT_86083
   00051 Fructose and mannose metabolism
    COCCADRAFT_86083
   00052 Galactose metabolism
    COCCADRAFT_86083
   00500 Starch and sucrose metabolism
    COCCADRAFT_86083
   00520 Amino sugar and nucleotide sugar metabolism
    COCCADRAFT_86083
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    COCCADRAFT_86083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bze04131]
    COCCADRAFT_86083
Enzymes [BR:bze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     COCCADRAFT_86083
Membrane trafficking [BR:bze04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    COCCADRAFT_86083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19152077
NCBI-ProteinID: XP_007708480
JGI: 86083
UniProt: W6YCG0
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MTTVLGSMADMPRDLKEQIEKLEEQFVVSTEKLKHISDHFVNELEKGLSEQGGSIPMIPT
WCMAFPDGNETGKYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELW
GYVADCLQQFIEYHHEGEQLADLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVQGVEGVDV
VPGFKAALEERGVPIKLAALVNDTTGTMIASAYTDTSIKIGCIFGTGCNAAYMEECGAIP
KLKHMNLDPKLPMAINCEWGAFDNEHQVLPRTKYDVIIDKESPRPGQQTFEKMVAGLYLG
EIFRLVLLDLHKGTECSMFQGQNASKLDKPYSLDAGFLSQIEEDRFENLQDTADLFQETL
GISCTKPELELIRRLAELIGTRAARLTACGVSAICKHKKWSEVHVGADGSVFSKYPHFKI
RQAQALKEIMDWPAKYGKGKNDPIEVLPAEDGSGVGAALIAALTVKRAQQGQLAGIRDQD
ALLAMGKTNKK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtgctaggttccatggcggacatgccccgggatctgaaggagcagattgag
aagctggaggagcagtttgtcgtctccacggaaaagctcaagcacatctcggatcacttt
gtcaatgagctcgagaagggactatcagagcaaggtggaagcattcctatgattccgacc
tggtgcatggcctttcccgatggcaacgagaccggaaaatatcttgcgcttgacatgggc
ggtacgaacctacgtgtttgcgaggttactctgacggaagagaagggagagtttgagatt
atacaatcaaagtaccgtatgcccgaggagctgaagactggaactgctgatgagctatgg
ggctacgtcgccgactgcctccagcaatttatcgagtaccaccacgagggcgaacagctc
gccgatctgcccctcggtttcaccttctcgtaccctgtctcgcaagatgctattgatcac
ggtgtcctacagcgatggaccaagggattcgatgtacaaggcgtggaaggtgtagatgtt
gtgcctggattcaaggcagctctggaggaacgcggcgtgcctatcaagctcgcggcgctg
gtcaacgacactactggtaccatgattgcctcagcgtataccgataccagcatcaaaatt
ggttgcatcttcggtacggggtgcaacgctgcctacatggaggagtgtggtgctattccc
aagctgaagcacatgaacctggacccaaaactgccaatggctatcaactgcgaatggggc
gcctttgacaacgaacatcaagttctgccacggacaaagtacgacgttataattgacaag
gagtcgcctcggccaggtcaacagacttttgagaagatggttgcaggtttgtaccttggc
gagattttccgtctagtcctcttggatcttcacaagggtacagaatgctccatgttccaa
ggccagaacgccagcaaactcgacaagccttactctcttgatgctggttttctctcccag
atcgaagaagaccgcttcgagaatttgcaagatacggccgatctattccaggagacactt
ggtatcagctgcactaagcctgaactcgaactaatccgccgacttgctgagcttattggt
acccgcgctgctcgtctgactgcctgcggtgtctctgctatctgcaagcacaagaaatgg
agcgaggtgcatgttggtgctgacggttccgtattcagcaaataccctcacttcaagatc
cgtcaagctcaggcactgaaggaaatcatggactggccagccaagtatggaaagggcaag
aacgatcctattgaggtgctacctgccgaggacggttccggtgttggtgctgcgctcatt
gctgcgcttacagtcaaacgtgcgcaacaaggacagctggctggtatcagggaccaggat
gcgctgcttgctatgggaaagaccaacaagaagtag

DBGET integrated database retrieval system