KEGG   Bipolaris zeicola: COCCADRAFT_94032Help
Entry
COCCADRAFT_94032  CDS       T03110                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bze  Bipolaris zeicola
Pathway
bze00052  Galactose metabolism
bze00500  Starch and sucrose metabolism
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCCADRAFT_94032
   00500 Starch and sucrose metabolism
    COCCADRAFT_94032
Enzymes [BR:bze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     COCCADRAFT_94032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19153678
NCBI-ProteinID: XP_007711481
JGI: 94032
UniProt: W6Y3H4
LinkDB All DBs
Position
Unknown
AA seq 908 aa AA seqDB search
MIRHILLGLAACSSLINAAPLVHEATDLAATLTRRAEVDSCPGYTASNVVEKDSTLTADL
TLAGDACNAYSDDIKNLKLLVEYQNNERLHVKIYDADLQVFQVQESVFPRPKHEQASTDS
TALQFDVKESPFSFTVKRRDGGEVLFDTETVPLVFEKQYVRLRTKLPDNPNIYGLGEHSD
SFRFHTDKYERVFLNGESINIPTNANLYGSHPVYFDHRGGKGTHGVFMLNSSPMQVDIKK
ADSGYQYLEYNTVGGVIDLYFMAGSKPAEVSKQYADVAGYSAMYPYWTLGFHQCKYGYWD
VNMVAEVVANYSTAGIPLEVMWTDIDYMNLREDFTTDPDRFPLSKMRELVSTLHSRDQKY
VLILDPGVHAVGNYEPYEKGHEMEVFLKAADGTDLLGVQWPGEVAWPDWFAPNTQEWWTQ
EILKQFDADSGINLDGLWVDMNEASNFCQDPQTCNPRQKAIDDGIPPKPGNAPRPNTGRP
IPGFPASFQPSSGNSSSAGVITPRQSANGSMKGFPDRNWFDPAYRVNSHLGKVSQQTIAM
NTTNYDGTWQYDTHNLYGSMMASATRESMLARRPKVRPFVLTRSTFAGIGRKVAHWFGDN
ASIWEHYRTSIRQMLSFVSMHQMPMVGSDVCGFNGNADQYMCARWAVLGAFQPFYRNHAE
LSTIQQEFYQWPVVANAAKKAIETRYKLMDYIYTALYYQTQDGTPMINPLFFLYPEDEKT
FDIQEQWFYGDALLISPVTVDYSDTVTFYLPNDVFYDYWTYGKVQGQGQNVTVSNLTYSD
IPVHIRGGSVIPHRVNSANTTKALRNEDFFVLVAPDAQGKAAGRLYLDDGESIEQAGTSE
INFSFDNGKFSATGSFGYKAQGAESVAVARVVVLGQAQKGATGEFDAEKQTIEVKGPWTL
DTEFGFEL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgatacgccatattttgctcgggcttgccgcctgctcgagcctcatcaatgcggcccct
ctagtgcacgaggctactgacctcgctgccacccttactcgccgcgccgaagtggatagc
tgccctggctatactgcctcgaatgttgtcgagaaagattctactttgacggccgacctc
actctcgctggtgacgcctgcaatgcgtacagcgacgatatcaagaatctgaagttgctc
gtcgagtaccaaaataatgagcgactacacgtcaaaatctacgatgccgacctccaggtt
ttccaggtccaagaatcagtcttccctcgaccaaagcatgaacaagcgtcaacggacagc
acagcccttcaatttgatgtcaaggagagtccattttcttttacagtcaagcgcagggat
ggtggtgaagttctttttgatactgaaaccgtccccctggtcttcgagaaacagtacgtg
cgccttcggaccaagctccctgacaacccaaacatctacggtctcggtgagcacagcgat
tcattccgcttccacacggataaatacgagcgtgtgtttttgaacggcgagtccattaac
attcccacaaacgccaatctttatggatctcacccagtgtattttgaccaccgtggtggc
aagggtactcatggtgttttcatgctcaactccagcccaatgcaagtggacatcaaaaag
gccgacagcggttaccagtacctcgagtacaatactgtcggtggagttattgacctatac
ttcatggctggaagcaagcccgctgaagtttccaagcaatacgccgacgttgccggctac
tctgcaatgtacccatactggacccttggtttccaccagtgcaagtacggatattgggac
gtcaacatggttgcggaagtcgttgccaactactccactgctggcattcctcttgaggtc
atgtggaccgatatcgactacatgaaccttcgcgaggactttaccaccgaccctgatcgt
ttcccgctctcaaagatgcgtgaattggtatcaactcttcactcgcgcgatcagaagtac
gtactgatcttggatcctggcgttcatgcagttggcaactatgagccttacgagaagggc
cacgaaatggaagttttcctcaaagccgccgatggcactgatctccttggagtccaatgg
cccggagaggtcgcatggcctgattggttcgcgcccaacacccaggagtggtggacacag
gaaatcctcaagcagttcgatgctgatagcggtattaaccttgacggactctgggtcgac
atgaacgaggcgtccaacttttgccaggatcctcagacttgcaacccgcgccaaaaagcc
attgatgatggtatcccaccaaagcctggaaatgctcctcgcccaaataccggtcgccct
attcccggcttcccagcatcgttccagccttcttctggtaacagctcatccgctggtgtc
attactccacgtcaatctgccaacggcagcatgaagggtttcccagaccgtaactggttt
gaccctgcttaccgcgtcaacagccatctcggtaaggtctcgcagcagaccattgccatg
aacacgacaaactacgatggaacctggcagtacgacacgcacaacctgtacggcagcatg
atggcctcggcgacccgcgaatccatgctcgcccgccgtcccaaggttcgtccctttgtc
ctcacccgctccacattcgcgggaatcggccgcaaagtagcacattggtttggtgacaac
gcttcgatctgggagcactaccgcacctccatccgccagatgctgtcctttgtctccatg
caccagatgcccatggtcggctccgacgtgtgcggcttcaacggcaacgcagaccaatac
atgtgcgcacgctgggccgtattgggcgccttccagcccttctaccgcaaccacgccgaa
ctcagcaccatccagcaagaattctaccaatggcccgttgtcgccaatgctgccaaaaag
gccattgaaacccgctacaaactcatggactacatctacaccgccctctactaccagact
caagacggcacaccaatgatcaacccgctcttcttcctctacccagaagacgaaaagact
tttgacatccaagaacaatggttctacggcgacgccctcctcatctcgcccgtgactgtc
gattactccgacacagtcaccttctacctgcccaacgacgtcttctacgactactggacg
tacggcaaagtgcagggccagggccaaaacgtcacagtcagtaacctaacctacagcgac
atccccgtgcatatccgcggcggaagcgtaatcccgcaccgcgtcaacagcgcgaatacc
acaaaggcgctgcgcaacgaggactttttcgtgctcgtggccccggatgcgcagggtaaa
gccgcggggcggttgtaccttgatgatggcgagagcatcgagcaagctggcactagcgag
attaacttttcgtttgataatggcaagttcagtgctacggggtcgtttgggtacaaggcg
cagggcgcggagagcgtcgcagttgcgcgggtggtggtgctgggacaggcgcaaaagggc
gcgacgggcgagtttgatgccgagaagcagactattgaggtcaaggggccgtggaccttg
gacacagagtttggctttgagttgtga

DBGET integrated database retrieval system