KEGG   Bipolaris zeicola: COCCADRAFT_95047Help
Entry
COCCADRAFT_95047  CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bze  Bipolaris zeicola
Pathway
bze00020  Citrate cycle (TCA cycle)
bze00480  Glutathione metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
bze01130  Biosynthesis of antibiotics
bze01200  Carbon metabolism
bze01210  2-Oxocarboxylic acid metabolism
bze01230  Biosynthesis of amino acids
bze04146  Peroxisome
Module
bze_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCCADRAFT_95047
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCCADRAFT_95047
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    COCCADRAFT_95047
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     COCCADRAFT_95047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19153873
NCBI-ProteinID: XP_007711858
JGI: 95047
UniProt: W6YQT3
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MRPAIAAPAAIRHASSIAHPSRRQTCAFATRCLASHSPATSAQLLSPRRPATITARTTPA
SLYTLVAQHRMASSSSVQKIKVKNPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDL
GLPYRDETDDQVTLDAAEAIKKYSVGVKCATITPDEQRVEEFKLKKMWLSPNGTIRNHLG
GTVFRAPIVIPTIPRLVPGWKQPIIIGRHAFGDQYRAKDRVIPGEGTLEMVFTPKGGKPE
VIKVYDFPAEGGVAQTQYNTTESISGFAHASFKMALDKKLPLYMSTKNTILKAYDGKFKD
VFQEIYDTQYKKDFEAAKIWYEHRLIDDMVAQMIKSEGGYVIAMKNYDGDVQSDIVAQGF
GSLGLMTSTLITPDGKTFEAEAAHGTVTRHYREHQKGKETSTNPIASIFAWTQGLAKRGE
LDNTPELVVFAETLEKACIDTVDVDKIMTKDLALACGKKDRASWVTTNEYLDAVERRLKS
SLKGKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggcaattgctgcccccgcggctatccgccatgcatcttcaattgcccatccc
tcccgtcgccagacttgtgcttttgcaactcgctgtttagcttctcactcgcctgcgaca
tcggcccaacttttgagcccgcgacgaccagcaacaatcactgccaggacaactcccgcc
agcctatacactctcgtcgcacagcacagaatggcgtcctcctcctcagtccagaagatc
aaggtcaaaaaccccgtcgtggagctcgacggtgatgagatgaccaggatcatctggcag
gtcatcaaggacaagtttatccacccttacctcgacattgacctcaagtactacgacctg
ggcctgccataccgtgatgagaccgacgaccaagtcacgctcgatgccgccgaggccatc
aaaaagtactcagttggtgtcaagtgcgcaaccattactccagacgagcagcgtgtagaa
gaattcaagctcaagaagatgtggttgtcgcccaatggcaccattcgaaaccatctagga
ggaaccgtcttccgcgcacccattgttatccccaccatccctcgtctcgtccctggatgg
aagcagcccatcatcattggccgtcacgctttcggcgaccagtaccgcgccaaggaccgt
gtcatccccggtgagggtaccttggaaatggtcttcacaccaaagggcggcaagcccgag
gtgatcaaggtctacgacttccctgcagagggtggtgtcgctcagacccagtacaacaca
accgagtccatctcgggcttcgcacatgcctcgttcaagatggcgctcgacaagaagctg
cctctgtacatgagcactaagaacaccattcttaaagcctacgacggaaagttcaaggat
gttttccaagaaatctacgacacccagtataagaaggactttgaggccgccaagatctgg
tacgagcaccgtctgattgacgacatggtcgctcagatgatcaagagcgagggtggctac
gttattgccatgaagaactacgacggagacgtccaatctgacattgtcgctcagggtttc
ggctctcttggtctcatgacttccacactcatcacccccgacggcaagacgttcgaggct
gaggccgcgcacggtaccgttacccgccactaccgcgagcaccaaaagggcaaggagaca
tctactaaccccattgcctccatctttgcctggacacaaggtctggccaagcgtggcgag
ctcgacaacacccctgaacttgtcgtctttgccgagacgctcgagaaggcttgcatcgac
acggtcgatgttgacaagatcatgaccaaggatctggcgctagcgtgcggaaagaaggat
agggctagctgggtcacaaccaacgagtacctggacgcagtggaacgaaggctcaagtcg
agtttgaagggaaagctatag

DBGET integrated database retrieval system