KEGG   Bipolaris zeicola: COCCADRAFT_9676Help
Entry
COCCADRAFT_9676   CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bze  Bipolaris zeicola
Pathway
bze00250  Alanine, aspartate and glutamate metabolism
bze00410  beta-Alanine metabolism
bze00430  Taurine and hypotaurine metabolism
bze00650  Butanoate metabolism
bze01100  Metabolic pathways
bze01110  Biosynthesis of secondary metabolites
Module
bze_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    COCCADRAFT_9676
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCCADRAFT_9676
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCCADRAFT_9676
   00430 Taurine and hypotaurine metabolism
    COCCADRAFT_9676
Enzymes [BR:bze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCCADRAFT_9676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19154222
NCBI-ProteinID: XP_007717864
JGI: 9676
UniProt: W6XQF4
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MAGLARHVDTEELLTTLKDHPMHKAGGRHSENRATSHITPYSSRYAAGTELSKFKIPQDG
APADVVHQLLKDELDLDGRPSLNLASFVGTYMEREGEQLMIENISKNLSDADEYPAMMDM
HARCVSIIAHMWGVQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRIAEGKDTSKPNII
MGANAQVALEKFARYFEVEARILPVSEDSSYRLDPKLVKENIDENTIGVFVILGSTYTGH
YEPVEEISEILDEFEKKTGVDIPIHVDAASGGFIAPFTHAKAGRKWNFELPRVKSINTSG
HKFGLVYAGVGWIIWRDESYLPKHLIFELHYLGGTEESYTLNFSRPGAQIIAQYYNLIHL
GFSGYRSIMENTLANARLLSRALEHTGWYRCVSDIHRKKGDFKYERGKEQYEEGATSEAY
NPGLPVVAFTLTDDFHKEFPHVKQEAVSNLLRAKQYIIPNYPLPPKEEKTEILRVVVRES
LSIDMIDRLVTDICGVTEMLMKTDAIDLAAFQPGANPSVEKQHASKGLRKEHKHKAQRPT
KHGVYRTVC
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccggactagcaagacacgttgacacggaagagctcttgacaacgctcaaagaccat
cctatgcacaaggctggtggacgtcattccgaaaaccgagcaacttcgcacatcacccct
tactccagtcgatatgctgctggtaccgagctgtccaagttcaaaattccacaagatggt
gcccctgcagatgttgttcaccagttactcaaagatgagcttgacctagatggacgacct
agccttaaccttgcttcattcgtcggcacctacatggagagggagggcgagcagctcatg
attgaaaacatatcaaagaatctgtcggatgctgatgagtacccagccatgatggacatg
catgctcgttgcgtttccattattgcccacatgtggggtgtgcaaaagggcgaaaaggcc
attggatccgccaccactggctctagtgaggccattcaccttggtgggctcgctatgaag
cgtcgctggcaggaaaagagaatagccgagggcaaggacacttcgaagccgaacatcatc
atgggtgccaatgctcaggtagcattggagaagtttgccaggtactttgaagtcgaggcc
cgtattctccccgtaagcgaggattcatcctaccgcctagatcccaagctagtcaaggag
aatatcgacgagaacactatcggagtttttgtcatcctcggctccacctacaccggacat
tatgagcctgttgaagagatttcggaaatcttggacgaattcgagaagaagactggagtc
gacattccaattcacgtcgatgcggcatcaggtggcttcattgccccctttacccatgca
aaagcaggcaggaaatggaatttcgagttgccgcgggtgaagtcgatcaacaccagtgga
cataaatttggacttgtgtatgccggtgttggatggatcatatggcgagatgagagctac
ctaccaaagcatttaatctttgaactccactacctgggtggaactgaggagtcgtacaca
ttgaacttctcacgaccgggcgcgcagattattgcacaatactacaacctgattcatctg
ggtttctcgggataccgcagcattatggagaacaccttggccaatgcccgcctattgagc
agggcgctggaacacacgggctggtataggtgtgtcagcgacattcaccgcaaaaagggt
gacttcaagtacgaaaggggcaaggagcagtacgaagaaggcgctacgagcgaagcttac
aaccccggtctacccgtcgtagcctttaccctcaccgatgacttccacaaagaattcccg
catgtcaagcaagaagccgttagcaatctgctccgtgccaagcaatacattattcccaac
tacccgctacctcccaaagaggagaagactgagattctaagagtagtagtcagagagtct
ctctcgatcgacatgatcgacaggcttgtgactgacatctgcggcgtgacggaaatgctt
atgaagacggatgccatcgaccttgcggcgttccaaccaggcgccaatcctagcgtcgag
aagcagcatgctagcaaaggcctgaggaaggagcacaagcacaaggctcagcggccgaca
aaacatggcgtctaccgaacggtgtgttag

DBGET integrated database retrieval system